DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hira and HIR2

Sequence 1:NP_572401.2 Gene:Hira FlyBaseID:FBgn0022786 Length:1047 Species:Drosophila melanogaster
Sequence 2:NP_014681.1 Gene:HIR2 SGDID:S000005564 Length:875 Species:Saccharomyces cerevisiae

Alignment Length:1003 Identity:195/1004 (19%)
Similarity:346/1004 (34%) Gaps:324/1004 (32%)


  Fly     1 MRLLKPAWVHHDDKQIFSVDIHKDCTK--------FATGGQGSDCGRVVIW---NLLPVLSDKAE 54
            |||||           :.:|||.:...        ....|.|   |.|:.|   .|:....|:..
Yeast     1 MRLLK-----------YPLDIHNEQVNALAALGPYIILAGSG---GHVMAWRQQQLVDTAFDRVM 51

  Fly    55 FDADVPKMLCQMDQHLACVNCVRWSQNG---------QNLASGSDDKLIMIWRKSAGSSGVFGTG 110
            .....|::..|:||          ...|         :.|..||:.:|   |    |.||     
Yeast    52 IKDLKPEVSFQVDQ----------DTTGDIFFITGDLETLYIGSEHRL---W----GYSG----- 94

  Fly   111 GMQKNHESWKCFYTLRGHDGDVLDLAWSPNDVYLASC----------------------SIDNTV 153
                    |.|      .|.:.::.....|...|..|                      |.:|.:
Yeast    95 --------WLC------RDTNNINSVEKMNSKLLFECKSPSTITDVKYDINLGILFVLLSNENKI 145

  Fly   154 IIWDAQAFPH-SVATL----KGHTGLVKGVSWDPLGRFLASQSDDRSIKIWNTMNWSLSHTITEP 213
            :::..:.|.. |..|:    |..||::     ||.|:.....:.||||.::. :|.:.:|.:...
Yeast   146 LLFRHKTFDKLSEITIDKASKPITGII-----DPTGQTFTVMTSDRSILVYQ-INKTGTHKLINK 204

  Fly   214 FEECGGTTHI------LRLSWSPDGQYL-----VSAHAMNGGGPTAQIIEREGWKCDKDFV---- 263
            .     |.|:      .|:|.||....|     |.....|....||.:.....:|..|..|    
Yeast   205 L-----TQHVQMYPLHYRISMSPQADILPVINSVKGVPNNATSCTALLDRNNNYKVTKTLVTPSS 264

  Fly   264 -GHRKAVTCVRFHNSILSRQENDGSPSKP-------LQYCCLAV-GSRDRSLSVWMTALQRPMVV 319
             |.|..|....|:             .||       .:|..:|. ||.|.::.||.|...:|:..
Yeast   265 NGCRVLVYSPAFY-------------EKPNLKKGTSTRYNLIATSGSTDGTILVWNTKRMKPLFN 316

  Fly   320 IHELFNASILDLTWGPQECLLMACSVDGSIACLKFTEEELGKAISEEEQNAIIRKMYGKNYVNGL 384
            ..::.:.:|.|::|......|.|.|.|.::....|.|::||.|:.:.|    |:.:...|     
Yeast   317 ALQVSSTAINDMSWSQDGFTLFAISNDATLYTFAFQEKDLGVALPQTE----IKSLQEVN----- 372

  Fly   385 GKSAPVLEHPQRLLLPQG--------DKPTKFPLSNN---NEANQRPISKQTETRTKDGKRRITP 438
             |..|.||.|....:|:.        :..:..|:.|:   :...::|..|:|.....:|.:.|. 
Yeast   373 -KKLPKLEEPLAEQIPKSFPENIKLEESASAAPIPNDIGRSAVGKKPTKKKTANNQTNGIKTIQ- 435

  Fly   439 MFIPLHEDGPTSLSMNIVSSSGSSTTALTSCSAAIGTLP---AAAPTESAATPLMPLEPLVSKID 500
                     .||:..|..|.                |:|   ...|.|  |||            
Yeast   436 ---------STSMEFNTPSY----------------TVPRDLKRKPKE--ATP------------ 461

  Fly   501 LGRLDSRLKTQPASQRRQSLPFD--------PGQSNELLR--TPRLEEHQSSTCSPSNLNVTATG 555
                 |.:......|:::..|.|        |..|...:|  ||::.    ||...|.:|..   
Yeast   462 -----SNIAPGSKKQKKELQPIDFLDTGLLLPNTSFSRIRLATPKIR----STFKYSPINNP--- 514

  Fly   556 KSEFVKAALDYRLHVSNGHLKTQHGMLAKVTAS--DSKEMLWEFYVGSPLVNLNLCEKYAMLCSL 618
                     :..|.|.||....|...:.|:|:.  |..::|::.::...:......:.:...||.
Yeast   515 ---------NLILDVKNGSGNEQRPTIVKLTSKVLDQDQVLFQDFIPKLITICTAGDTFWSFCSE 570

  Fly   619 DGSMRLISMETG----CPVFPAISLTSSAVHCAFSPDNSLVGVLTECGLLRIWDIAKKVVSLAAG 679
            |||:.:.| ::|    .|:...:|: |....|     .:.:..||..|.|..|:|.:|.::....
Yeast   571 DGSIYIYS-DSGRKLMAPLVLGVSI-SFLEAC-----GTYLLCLTSIGELYCWNIEQKKLAFPTN 628

  Fly   680 CL------------ELLNKHGTAAQFSVTNQGMPLIGFPSGNSYSYSTSLQSWLVLATKDAIMYH 732
            .:            ::|.:.......|:|.:|:||:...:|:.|.:..::::||:::  |....:
Yeast   629 TIYPLLNPSLRYSDDILTRAENITLCSITKKGVPLVTLSNGDGYLFDKNMETWLLVS--DGWWAY 691

  Fly   733 GIRGTLPRDMDQMQQKFPLLSMQASSQNYFSFTGS---------------------MELRHSESW 776
            |         .|.........:.:|..|..||.||                     :|.:.::..
Yeast   692 G---------SQYWDTTNTTGLSSSKANTDSFNGSESNINEIVSDIKNDNQSIINFLECKTNDEL 747

  Fly   777 QQCAKIRFIE---NQIKLCEALQSLDELQHWHKMLTFQLATHGSEKRMRVFLDDLLSMPEPGISQ 838
            .:..:|:.::   ..|.:.|..::::|:      :|.      |....::.:...|..||    :
Yeast   748 NRKGRIKNLQRFARTILMKEGFENMEEI------VTL------SHLENKILISIRLEEPE----E 796

  Fly   839 FVPKLELMQCV-------LDTLKPHSEW 859
            | .||.::.|:       :|.|....:|
Yeast   797 F-SKLMMVYCIRLSELGYMDRLNDVFQW 823

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HiraNP_572401.2 WD40 <12..370 CDD:225201 88/429 (21%)
WD40 14..349 CDD:238121 82/406 (20%)
WD40 repeat 16..68 CDD:293791 13/63 (21%)
WD40 repeat 74..127 CDD:293791 11/62 (18%)
WD40 repeat 132..169 CDD:293791 8/64 (13%)
WD40 repeat 176..211 CDD:293791 9/35 (26%)
WD40 repeat 223..263 CDD:293791 11/51 (22%)
WD40 repeat 275..322 CDD:293791 11/55 (20%)
WD40 repeat 328..350 CDD:293791 7/22 (32%)
HIRA_B 423..442 CDD:286531 4/19 (21%)
Hira 629..820 CDD:284895 38/231 (16%)
HIR2NP_014681.1 WD40 83..>367 CDD:225201 73/338 (22%)
WD40 repeat 123..163 CDD:293791 5/40 (13%)
WD40 repeat 169..207 CDD:293791 12/49 (24%)
WD40 <172..350 CDD:295369 45/202 (22%)
WD40 repeat 268..318 CDD:293791 14/63 (22%)
Hira 580..816 CDD:284895 46/270 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C343470736
eggNOG 1 0.900 E1_KOG0973
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I1657
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13831
Phylome 1 0.910 0.963 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.