DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hira and hip1

Sequence 1:NP_572401.2 Gene:Hira FlyBaseID:FBgn0022786 Length:1047 Species:Drosophila melanogaster
Sequence 2:NP_596575.1 Gene:hip1 PomBaseID:SPBC31F10.13c Length:932 Species:Schizosaccharomyces pombe

Alignment Length:982 Identity:262/983 (27%)
Similarity:440/983 (45%) Gaps:169/983 (17%)


  Fly     1 MRLLKPAWV-HHDDK----QIFSVDIHKDCTKFATGGQGSDCGRVVIWNLLPV--LSDKAEFDAD 58
            |::.|..|: |.||:    .|||:.||.|.::.||||..   |.:.||:...:  .::....:.|
pombe     1 MKIKKIPWLGHFDDRGHRLSIFSIHIHPDGSRIATGGLD---GTIRIWSTEAINRENENENENED 62

  Fly    59 VPKMLCQMDQHLACVNCVRWSQNGQNLASGSDDKLIMIWRKS---AGSSGVFGTGGMQKNHESWK 120
            :||.||.|..|...|..||:|.|||.|||||||::::||.|.   .|....||:|  :|:.|:|:
pombe    63 LPKQLCCMSTHTGTVTSVRFSPNGQYLASGSDDRVVIIWHKEEAIPGLGSTFGSG--EKHTENWR 125

  Fly   121 CFYTLRGHDGDVLDLAWSPNDVYLASCSIDNTVIIWDAQAFPHSVATLKGHTGLVKGVSWDPLGR 185
            .:..|.|||.|:.||.||.:...:.|..:|:::|:|:...| ..:..::.|...|||:::||.|:
pombe   126 SYRRLLGHDNDIQDLCWSYDSQLVVSVGLDSSIIVWNGTTF-ERLKRIEAHQSHVKGITFDPAGK 189

  Fly   186 FLASQSDDRSIKIWNTMNWSLSHTITEPFEECGGTTHILRLSWSPDGQYLVSAHAMNGGGPTAQI 250
            :.|::||||:||:|...::|:..|||.||.....:|:..|.||||||:::.:.:||||......|
pombe   190 YFATESDDRTIKVWRVSDFSIEKTITGPFNNSPLSTYFRRPSWSPDGKHIAAPNAMNGPVSCVSI 254

  Fly   251 IEREGWKCDKDFVGHRKAVTCVRFHNSILSRQENDGSPSKPLQYCCLAVGSRDRSLSVWMTALQR 315
            |||..|..:.:.:||...|....| |..|.|.:||      ...|.||.|.:|||||:|.:||.|
pombe   255 IERGTWTSEINLIGHEGPVEVTAF-NPKLFRDKND------KLVCILACGGQDRSLSIWSSALPR 312

  Fly   316 PMVVIHELFNASILDLTWGPQECLLMACSVDGSIACLKFTEEELGKAISEEE-QNAIIRKMYGKN 379
            |::....:|..||.|:.|.|....|..||.||::....|.:||.|..:|:|| ..|:.:..:|::
pombe   313 PLLSCQNVFQKSIGDVCWSPDGLSLFLCSYDGNVLVCTFEKEEFGDMVSDEEISKALAKYGHGRH 377

  Fly   380 YVNGLGKSA----------PVLEHPQRL------LLPQGDK--------PTKFPL---------- 410
            .: .|.:||          .:|:.|..|      |:||...        |.|.|.          
pombe   378 GI-VLPESAKQLELEETAYAILKKPSSLSTTDPTLVPQSSSTPKSAQKTPQKLPAFLPNRLTAET 441

  Fly   411 --SNNNEANQRPISK------------------QTETRTKDGKRRITPMFIPLHEDGPTS--LSM 453
              :|...|::..|:.                  |..|.||:||:|:.|..:......|::  |:.
pombe   442 VDTNKLTASKEQIASPKRPGPSDNGNEIPTKFVQKVTITKEGKKRVAPQLLTTLSATPSTSRLAS 506

  Fly   454 NIVSSSGSSTTALTSCSAAIGTLPAAAPTESAATPLMPLEPLVSKIDLGRLDSRLKTQPASQRRQ 518
            ..:..:|||.......|..|.:||      ....|::    :|..          ||:...:..:
pombe   507 TQLQHTGSSQLPPQQFSQPINSLP------KGGVPIL----IVGN----------KTKVNHENDE 551

  Fly   519 SLPFDPGQSNELLRTPRLEEHQS----STCSPSNLNVTATGKSEFVKAALD----YRLHVSNGHL 575
            |   |.....|.:....|:.:.|    |:.|.||:|..|......:..:|:    |.|.|.||  
pombe   552 S---DQALQEEKIEEGLLKNYYSSLIDSSTSISNINFEAPRYKTNIVHSLNNEQKYVLEVKNG-- 611

  Fly   576 KTQHGMLAKVTASDSKEMLWEFYVGSPLVNLNLCEKYAMLCSLDGSMRLISMETGCPVFPAISLT 640
             |......::.|.::....|..|:..|::.:.....:..:...|||:.|.|: ||..:.|.|.:.
pombe   612 -TSEKNPTRIVALENGNTKWMDYLPRPVILVTGSIHFWSIACDDGSLHLYSL-TGSRLLPPIMIE 674

  Fly   641 SSA--VHCAFSPDNSLVGVLTECGLLRIWDIAKKVVSLAAGCL-ELLNK---------------H 687
            |.|  :||    :|:.:..::..|::..|::..|.....|..| .:|::               |
pombe   675 SKASFLHC----NNAYLLCISSSGMVYAWNVVNKTALFTANSLAPILSRVSNNVTIENNSTDIPH 735

  Fly   688 GTAAQFSVTNQGMPLIGFPSGNSYSYSTSL-------QSWLVLATKDAIMYHGIRGTLPRDMDQM 745
            ...|  |::.:|:|.:...:|.:|.||:::       :.|..:.:::    ....|.|..:....
pombe   736 VVIA--SISKEGVPSVTLSTGETYVYSSTMLCWQRITEPWWAIGSRE----WDSSGLLQSNTQTE 794

  Fly   746 QQKFPLLSMQASSQNYFSFTGSMELRHS-----------ESWQQCAKIRFIENQIKLCEALQSLD 799
            .|  ||...:..:.|....:|..:|...           :.::....|..:||:|.....|:..|
pombe   795 SQ--PLKIYEHRTNNVLMDSGRGKLLQKMVADAITEEGYDDFETIVTINHLENKIASARLLKLDD 857

  Fly   800 ELQHWHKMLTFQLATHGSEKRMRVFLDDLLSMPEPGIS----QFVPK-LELMQCVLDTLKPHSEW 859
            |.....::....|..||..:::..||.:|.:..:..|.    :.|.| |.:::..:.|.......
pombe   858 EFLVTSEVYVRLLMHHGLWQKLEEFLGELRTQTKCSIKLSGREVVAKMLVVLRQAVQTDNEFDRA 922

  Fly   860 NRLHSEY 866
            |:|..:|
pombe   923 NKLIEKY 929

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HiraNP_572401.2 WD40 <12..370 CDD:225201 139/368 (38%)
WD40 14..349 CDD:238121 130/344 (38%)
WD40 repeat 16..68 CDD:293791 19/54 (35%)
WD40 repeat 74..127 CDD:293791 24/56 (43%)
WD40 repeat 132..169 CDD:293791 9/37 (24%)
WD40 repeat 176..211 CDD:293791 16/35 (46%)
WD40 repeat 223..263 CDD:293791 16/40 (40%)
WD40 repeat 275..322 CDD:293791 19/47 (40%)
WD40 repeat 328..350 CDD:293791 9/22 (41%)
HIRA_B 423..442 CDD:286531 8/37 (22%)
Hira 629..820 CDD:284895 43/227 (19%)
hip1NP_596575.1 WD40 15..348 CDD:238121 130/346 (38%)
WD40 <15..348 CDD:225201 130/346 (38%)
WD40 repeat 21..69 CDD:293791 18/51 (35%)
WD40 repeat 78..132 CDD:293791 24/56 (43%)
WD40 repeat 137..173 CDD:293791 9/37 (24%)
WD40 repeat 180..215 CDD:293791 16/35 (46%)
WD40 repeat 222..267 CDD:293791 17/45 (38%)
WD40 repeat 275..322 CDD:293791 21/54 (39%)
WD40 repeat 325..347 CDD:293791 9/22 (41%)
HIRA_B 475..495 CDD:286531 8/20 (40%)
Hira 663..878 CDD:284895 43/227 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 300 1.000 Inparanoid score I595
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002367
OrthoInspector 1 1.000 T1124341
orthoMCL 1 0.900 OOG5_129080
Panther 1 1.100 LDO PTHR13831
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R561
TreeFam 1 0.960
109.960

Return to query results.
Submit another query.