DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hira and Hira

Sequence 1:NP_572401.2 Gene:Hira FlyBaseID:FBgn0022786 Length:1047 Species:Drosophila melanogaster
Sequence 2:XP_006521861.1 Gene:Hira MGIID:99430 Length:1030 Species:Mus musculus

Alignment Length:1043 Identity:382/1044 (37%)
Similarity:542/1044 (52%) Gaps:201/1044 (19%)


  Fly     5 KPAWV-----HHDD---------KQIFSVDIHKDCTKFATGGQGSDCGRVVIWNLLPVLSDKAEF 55
            :||||     |...         |.|||||||.|.|||||||||.|.|:|||||:.|||.:..|.
Mouse     6 EPAWVPTWCCHPASPSSMCSDGWKPIFSVDIHPDGTKFATGGQGQDSGKVVIWNMSPVLQEDDEK 70

  Fly    56 DADVPKMLCQMDQHLACVNCVRWSQNGQNLASGSDDKLIMIWRKSA--GSSGVFGTGGMQKNHES 118
            |.::||||||||.|||||||||||.:|..||||.||||||:|:::.  |.|.|||:.|...|.|.
Mouse    71 DENIPKMLCQMDNHLACVNCVRWSNSGMYLASGGDDKLIMVWKRATYIGPSTVFGSSGKLANVEQ 135

  Fly   119 WKCFYTLRGHDGDVLDLAWSPNDVYLASCSIDNTVIIWDAQAFPHSVATLKGHTGLVKGVSWDPL 183
            |:|...||.|.|||:|:||||:|.:|||||:||||:||:|..||..:|||:||:|||||::|||:
Mouse   136 WRCVSILRSHSGDVMDVAWSPHDAWLASCSVDNTVVIWNAVKFPEILATLRGHSGLVKGLTWDPV 200

  Fly   184 GRFLASQSDDRSIKIWNTMNWSLSHTITEPFEECGGTTHILRLSWSPDGQYLVSAHAMNGGGPTA 248
            |:::|||:||||:|:|.|::|.|..:||:||:|||||||:|||||||||.|||||||||..||||
Mouse   201 GKYIASQADDRSLKVWRTLDWQLETSITKPFDECGGTTHVLRLSWSPDGHYLVSAHAMNNSGPTA 265

  Fly   249 QIIEREGWKCDKDFVGHRKAVTCVRFHNSILSRQENDGSPSKP-LQYCCLAVGSRDRSLSVWMTA 312
            |||||||||.:.||||||||||.|:|:..|..:::.:||.:|| ..|||.||||:|||||||:|.
Mouse   266 QIIEREGWKTNMDFVGHRKAVTVVKFNPKIFKKKQKNGSSTKPSCPYCCCAVGSKDRSLSVWLTC 330

  Fly   313 LQRPMVVIHELFNASILDLTWGPQECLLMACSVDGSIACLKFTEEELGKAISEEEQNAIIRKMYG 377
            |:||:|||||||:.||:|::|......::.||:|||:|.|.|:::|||..:||||::.|.:..||
Mouse   331 LKRPLVVIHELFDKSIMDISWTLNGLGILVCSMDGSVAFLDFSQDELGDPLSEEEKSRIHQSTYG 395

  Fly   378 KN--YVNGLGKSAPVLEHPQRLLLPQGDKPTKFPLSN----------------NNEA----NQRP 420
            |:  .:.....|..|:|:|:.|...:..:..:....|                |.|:    .:..
Mouse   396 KSLAIMTEAQLSTAVIENPEMLKYQRRQQQQQLDQKNATTRETSSASSVTGVVNGESLEDIRKNL 460

  Fly   421 ISKQTETRTKDGKRRITPMFIPLHEDG------------PTSLSMNIVSS-SGSSTTALTSCSAA 472
            :.||.||||.||:|||||:.|...:.|            .:||:..::|| ||.....|.|.:.:
Mouse   461 LKKQVETRTADGRRRITPLCIAQLDTGDFSTAFFNSIPLSSSLAGTMLSSPSGQQLLPLDSSTPS 525

  Fly   473 IG-----TLPAAA------------------PTESAATPLMPLEPLVSKID-LGRLDSRLKTQPA 513
            .|     |.|.||                  .|.:|::|.:...|  |||: :...|||.     
Mouse   526 FGASKPCTEPVAATSARPTGESVSKDSMNATSTPAASSPSVLTTP--SKIEPMKAFDSRF----- 583

  Fly   514 SQRRQSLPFDPG------------QSNELLRTPRLEEHQSSTCS--------------------- 545
            ::|.::.|..|.            :...|::..|..|.:||:.|                     
Mouse   584 TERSKATPGAPSLTSVIPTAVERLKEQNLVKELRSRELESSSDSDEKVHLAKPSSLSKRKLELEV 648

  Fly   546 ------------------PSNLNVTATGKSEFVKAAL------------------DYRLHVSN-- 572
                              |.:|:|.:.......|.|:                  .:.|.||:  
Mouse   649 ETVEKKKKGRPRKDSRLLPMSLSVQSPAALSTEKEAMCLSAPALALKLPIPGPQRAFTLQVSSDP 713

  Fly   573 -------GHLKTQHGM-LAKVTAS-DSKEMLWEFYVGS-PLVNLNLCEKYAMLCSLDGSMRLISM 627
                   ..:.|..|: |:::..: :.||  ||..:.| .|.....|:...:.|    ..|::|:
Mouse   714 SMYIEVENEVTTVGGIRLSRLKCNREGKE--WETVLSSRVLTAAGSCDVVCVAC----EKRMLSV 772

  Fly   628 ETGC--PVFPAISLTS--SAVHCAFSPDNSLVGVLTECGLLRIWDIAKKVVSLAAGCLE--LLNK 686
            .:.|  .:.|.|.|.|  |.:||.    ...|..||....|.:||:.::||.:....|.  |...
Mouse   773 FSTCGRRLLPPILLPSPISTLHCT----GPYVMALTAAATLSVWDVHRQVVVVKEESLHSILSGS 833

  Fly   687 HGTAAQFSVTNQGMPLIGFPSGNSYSYSTSLQSWLVLATKDAIMYH--GIRGTLPRDMDQMQQKF 749
            ..|.:|..:|..|:|::....|.:|.::.||.:|.:::.|...:..  ..|.:|| ..|.|....
Mouse   834 DMTVSQILLTQHGIPVMNLSDGKAYCFNPSLSTWNLVSDKQDSLAQCADFRNSLP-SQDAMLCSG 897

  Fly   750 PLLSMQASSQNYFSFTGSMELR-----HSESWQQCAKIRFIENQIKLCEALQSLDELQHWHKMLT 809
            ||..:|..:.|    :|....|     |..  ||...:.::|||:.....|||..|.:||..:..
Mouse   898 PLAIIQGRTSN----SGRQAARLFSVPHVV--QQETTLAYLENQVAAALTLQSSHEYRHWLLLYA 956

  Fly   810 FQLATHGSEKRMRVFLDDLLSMPEPGI-SQF------VPKLELMQCVLDTLKPHSEWNRLHSEYT 867
            ..|...|.|.|:|....|||....... ||:      :.|.||::.:|..:..:..:.||.:|..
Mouse   957 RYLVNEGFEYRLREICKDLLGPVHCSTGSQWESTVVGLRKRELLKELLPVIGQNLRFQRLFTECQ 1021

  Fly   868 ELL 870
            |.|
Mouse  1022 EQL 1024

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HiraNP_572401.2 WD40 <12..370 CDD:225201 226/370 (61%)
WD40 14..349 CDD:238121 216/338 (64%)
WD40 repeat 16..68 CDD:293791 37/52 (71%)
WD40 repeat 74..127 CDD:293791 30/55 (55%)
WD40 repeat 132..169 CDD:293791 24/37 (65%)
WD40 repeat 176..211 CDD:293791 19/35 (54%)
WD40 repeat 223..263 CDD:293791 33/40 (83%)
WD40 repeat 275..322 CDD:293791 27/48 (56%)
WD40 repeat 328..350 CDD:293791 8/22 (36%)
HIRA_B 423..442 CDD:286531 14/19 (74%)
Hira 629..820 CDD:284895 55/204 (27%)
HiraXP_006521861.1 WD40 <29..387 CDD:225201 219/363 (60%)
WD40 29..367 CDD:238121 213/341 (62%)
WD40 repeat 31..76 CDD:293791 31/45 (69%)
WD40 repeat 89..144 CDD:293791 30/57 (53%)
WD40 repeat 149..186 CDD:293791 24/37 (65%)
WD40 repeat 193..228 CDD:293791 23/35 (66%)
WD40 repeat 241..280 CDD:293791 29/39 (74%)
WD40 repeat 288..339 CDD:293791 32/52 (62%)
WD40 repeat 346..369 CDD:293791 13/23 (57%)
HIRA_B 463..484 CDD:286531 8/44 (18%)
Hira 776..967 CDD:284895 30/104 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C343464299
eggNOG 1 0.900 E1_KOG0973
Hieranoid 1 1.000
Homologene 1 1.000 H48172
Inparanoid 1 1.050 625 1.000 Inparanoid score I857
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002367
OrthoInspector 1 1.000 T1082522
orthoMCL 1 0.900 OOG5_129080
Panther 1 1.100 LDO PTHR13831
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R561
TreeFam 1 0.960
1211.780

Return to query results.
Submit another query.