DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hira and C22orf39

Sequence 1:NP_572401.2 Gene:Hira FlyBaseID:FBgn0022786 Length:1047 Species:Drosophila melanogaster
Sequence 2:NP_776154.3 Gene:C22orf39 HGNCID:27012 Length:142 Species:Homo sapiens

Alignment Length:144 Identity:29/145 (20%)
Similarity:47/145 (32%) Gaps:55/145 (38%)


  Fly   766 GSMELRHSESWQQCAKIRFIENQIKLCEALQSLDELQHWHKMLTFQLATHGSEKRMRVFLDDLLS 830
            |..::.....||..........:.|||.:.:..  |.|::        .||.             
Human    34 GRPDMADGSGWQPPRPCEAYRAEWKLCRSARHF--LHHYY--------VHGE------------- 75

  Fly   831 MPEPGISQFVPKLELMQCVLDTLKPHSEW-NRLHSEYTELLKECKSER------QKDIFA----- 883
              .|...|:  :.:|..|        .:| .|.::|..:.|  |:|||      :|.|..     
Human    76 --RPACEQW--QRDLASC--------RDWEERRNAEAQQSL--CESERARVRAARKHILVWAPRQ 126

  Fly   884 TPAP------PQQK 891
            :|.|      ||:|
Human   127 SPPPDWHLPLPQEK 140

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HiraNP_572401.2 WD40 <12..370 CDD:225201
WD40 14..349 CDD:238121
WD40 repeat 16..68 CDD:293791
WD40 repeat 74..127 CDD:293791
WD40 repeat 132..169 CDD:293791
WD40 repeat 176..211 CDD:293791
WD40 repeat 223..263 CDD:293791
WD40 repeat 275..322 CDD:293791
WD40 repeat 328..350 CDD:293791
HIRA_B 423..442 CDD:286531
Hira 629..820 CDD:284895 10/54 (19%)
C22orf39NP_776154.3 DUF3128 50..125 CDD:288218 21/112 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C343465031
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.