DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hira and LOC100911837

Sequence 1:NP_572401.2 Gene:Hira FlyBaseID:FBgn0022786 Length:1047 Species:Drosophila melanogaster
Sequence 2:XP_008767127.1 Gene:LOC100911837 RGDID:6490647 Length:1010 Species:Rattus norvegicus

Alignment Length:1019 Identity:380/1020 (37%)
Similarity:537/1020 (53%) Gaps:185/1020 (18%)


  Fly    14 KQIFSVDIHKDCTKFATGGQGSDCGRVVIWNLLPVLSDKAEFDADVPKMLCQMDQHLACVNCVRW 78
            |.|||||||.|.|||||||||.|.|:|||||:.|||.:..|.|.::||||||||.||||||||||
  Rat     9 KPIFSVDIHPDGTKFATGGQGQDSGKVVIWNMSPVLQEDDEKDENIPKMLCQMDNHLACVNCVRW 73

  Fly    79 SQNGQNLASGSDDKLIMIWRKSA--GSSGVFGTGGMQKNHESWKCFYTLRGHDGDVLDLAWSPND 141
            |.:|..||||.||||||:|:::.  |.|.|||:.|...|.|.|:|...||.|.|||:|:||||:|
  Rat    74 SNSGMYLASGGDDKLIMVWKRATYIGPSTVFGSSGKLANVEQWRCVSILRSHSGDVMDVAWSPHD 138

  Fly   142 VYLASCSIDNTVIIWDAQAFPHSVATLKGHTGLVKGVSWDPLGRFLASQSDDRSIKIWNTMNWSL 206
            .:|||||:||||:||:|..||..:|||:||:|||||::|||:|:::|||:||||:|:|.|::|.|
  Rat   139 AWLASCSVDNTVVIWNAVKFPEILATLRGHSGLVKGLTWDPVGKYIASQADDRSLKVWRTLDWQL 203

  Fly   207 SHTITEPFEECGGTTHILRLSWSPDGQYLVSAHAMNGGGPTAQIIEREGWKCDKDFVGHRKAVTC 271
            ..:||:||:|||||||:|||||||||.|||||||||..|||||||||||||.:.||||||||||.
  Rat   204 ETSITKPFDECGGTTHVLRLSWSPDGHYLVSAHAMNNSGPTAQIIEREGWKTNMDFVGHRKAVTV 268

  Fly   272 VRFHNSILSRQENDGSPSKP-LQYCCLAVGSRDRSLSVWMTALQRPMVVIHELFNASILDLTWGP 335
            |:|:..|..:::.:||.:|| ..|||.||||:|||||||:|.|:||:|||||||:.||:|::|..
  Rat   269 VKFNPKIFKKKQKNGSSAKPSCPYCCCAVGSKDRSLSVWLTCLKRPLVVIHELFDKSIMDISWTL 333

  Fly   336 QECLLMACSVDGSIACLKFTEEELGKAISEEEQNAIIRKMYGKN--YVNGLGKSAPVLEHPQRLL 398
            ....::.||:|||:|.|.|:::|||..:||||::.|.:..|||:  .:.....|..|:|:|:.|.
  Rat   334 NGLGILVCSMDGSVAFLDFSQDELGDPLSEEEKSRIHQSTYGKSLAIMTEAQLSTAVIENPEMLK 398

  Fly   399 LPQGDKPTKFPLSN----------------NNEA----NQRPISKQTETRTKDGKRRITPMFIPL 443
            ..:..:..:....|                |.|:    .:..:.||.||||.||:|||||:.|..
  Rat   399 YQRRQQQQQLDQKNATTRETSSASSVTGVVNGESLEDIRKNLLKKQVETRTADGRRRITPLCIAQ 463

  Fly   444 HEDG------------PTSLSMNIVSS-SGSSTTALTSCSAAIG-----TLPAAA----PT---- 482
            .:.|            .:||:..::|| ||.....|.|.:.:.|     |.|.||    ||    
  Rat   464 LDTGDFSTAFFNSIPLSSSLAGTMLSSPSGQQLLPLDSSTPSFGASKPCTEPVAATSARPTGEPV 528

  Fly   483 -----ESAATPLMPLEPLV----SKID-LGRLDSRLKTQPASQRRQSLPFDPG------------ 525
                 .:.:|| ..|.|.|    |||: :...|||.     ::|.::.|..|.            
  Rat   529 SKDSMNATSTP-AALSPSVLTTPSKIEPMKAFDSRF-----TERSKATPGAPSLTSVIPTAVERL 587

  Fly   526 QSNELLRTPRLEEHQSSTCS---------------------------------------PSNLNV 551
            :...|:|..|..|..||:.|                                       |.:|:|
  Rat   588 KEQNLVRELRSRELDSSSDSDEKVHLAKPSSLSKRKLELEVETVEKKKKGRPRKDSRLLPVSLSV 652

  Fly   552 TATGKSEFVKAAL------------------DYRLHVSN---------GHLKTQHGM-LAKVTAS 588
            .:.......|.|:                  .:.|.||:         ..:.|..|: |:::..:
  Rat   653 QSPAALSAEKEAMCLSAPALALKLPIPGPQRAFTLQVSSDPSMYIEVENEVTTVGGIRLSRLKCN 717

  Fly   589 -DSKEMLWEFYVGS-PLVNLNLCEKYAMLCSLDGSMRLISMETGC--PVFPAISLTS--SAVHCA 647
             :.||  ||..:.| .|.....|:...:.|    ..|::|:.:.|  .:.|.|.|.|  |.:||.
  Rat   718 REGKE--WETVLSSRVLTAAGSCDVVCVAC----EKRMLSVFSTCGRRLLPPILLPSPISTLHCT 776

  Fly   648 FSPDNSLVGVLTECGLLRIWDIAKKVVSLAAGCLE--LLNKHGTAAQFSVTNQGMPLIGFPSGNS 710
                ...|..||....|.:||:.::||.:....|.  |.....|.:|..:|..|:|::....|.:
  Rat   777 ----GPYVMALTAAATLSVWDVHRQVVVVKEESLHSILSGSDMTVSQILLTQHGIPVMNLSDGKA 837

  Fly   711 YSYSTSLQSWLVLATKDAIMYH--GIRGTLPRDMDQMQQKFPLLSMQASSQNYFSFTGSMELR-- 771
            |.::.||.:|.:::.|...:..  ..|.:|| ..|.|....||..:|..:.|    :|....|  
  Rat   838 YCFNPSLSTWNLVSDKQDSLAQCADFRNSLP-SQDAMLCSGPLAIIQGRTSN----SGRQAARLF 897

  Fly   772 ---HSESWQQCAKIRFIENQIKLCEALQSLDELQHWHKMLTFQLATHGSEKRMRVFLDDLLSMPE 833
               |..  ||.:.:.::|:|:.....|||..|.:||..:....|...|.|.|:|....|||....
  Rat   898 SVPHVV--QQESTLAYLESQVAAALTLQSSHEYRHWLLLYARYLVNEGFEYRLREICQDLLGPVH 960

  Fly   834 PGI-SQF------VPKLELMQCVLDTLKPHSEWNRLHSEYTELL 870
            ... ||:      :.|.||::.:|..:..:..:.||.:|..|.|
  Rat   961 CSTGSQWESTVVGLRKRELLKELLPVIGQNLRFQRLFTECQEQL 1004

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HiraNP_572401.2 WD40 <12..370 CDD:225201 226/359 (63%)
WD40 14..349 CDD:238121 216/338 (64%)
WD40 repeat 16..68 CDD:293791 37/52 (71%)
WD40 repeat 74..127 CDD:293791 30/55 (55%)
WD40 repeat 132..169 CDD:293791 24/37 (65%)
WD40 repeat 176..211 CDD:293791 19/35 (54%)
WD40 repeat 223..263 CDD:293791 33/40 (83%)
WD40 repeat 275..322 CDD:293791 27/48 (56%)
WD40 repeat 328..350 CDD:293791 8/22 (36%)
HIRA_B 423..442 CDD:286531 14/19 (74%)
Hira 629..820 CDD:284895 54/204 (26%)
LOC100911837XP_008767127.1 WD40 <9..367 CDD:225201 226/358 (63%)
WD40 9..347 CDD:238121 216/338 (64%)
WD40 repeat 11..56 CDD:293791 30/45 (67%)
WD40 repeat 69..124 CDD:293791 30/55 (55%)
WD40 repeat 129..166 CDD:293791 24/37 (65%)
WD40 repeat 173..208 CDD:293791 19/35 (54%)
WD40 repeat 221..260 CDD:293791 33/39 (85%)
WD40 repeat 268..319 CDD:293791 28/51 (55%)
WD40 repeat 326..349 CDD:293791 9/23 (39%)
HIRA_B 443..464 CDD:286531 14/21 (67%)
Hira 756..947 CDD:284895 54/202 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C343468929
eggNOG 1 0.900 E1_KOG0973
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 624 1.000 Inparanoid score I807
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002367
OrthoInspector 1 1.000 T617609
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13831
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.980

Return to query results.
Submit another query.