DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18155 and AAE13

Sequence 1:NP_996360.2 Gene:CG18155 FlyBaseID:FBgn0029945 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_001319565.1 Gene:AAE13 AraportID:AT3G16170 Length:608 Species:Arabidopsis thaliana

Alignment Length:609 Identity:155/610 (25%)
Similarity:236/610 (39%) Gaps:125/610 (20%)


  Fly    35 HSFDEEERS--NVVVPTFKKAMLYPDEIAVKDINGEYTYFQLYMAAKRL------------GIQI 85
            |.|..:..|  .|....|.:|....|.||:|.....|:|.||..:|.|:            |.:.
plant    55 HLFSSQSGSLMEVFKAAFSEASNSCDRIAIKADGKSYSYGQLTSSALRISKLFLKDDTTNGGQET 119

  Fly    86 SNICGGAAL--SNVTYLCSNNALWIAIQWSCWISGQVAVPLESGQAIDQLQRQASNCKTKLLIAT 148
            ....|..:|  :.:..:...:|.::|.....|.||.|||||.......:|....::....||::|
plant   120 KKYEGFGSLKGARIGIVAKPSAEFVAGVLGTWFSGGVAVPLALSYPEAELLHVMNDSDISLLLST 184

  Fly   149 KEFESLAQELSQGVKSATIILDHSFLPTAESVSSTSMYAKQLVAIQGVIVTENTFPNDFYSKA-- 211
            ::.....:.::  .||....  |...|...|.|.|              |..|.|.:|.:...  
plant   185 EDHSETMKTIA--AKSGARF--HLIPPVVNSTSET--------------VACNQFQDDSFEAEGK 231

  Fly   212 ----PAMLIYTPNAVNSPKPVLLTHRNIEAQMRCLIGTWHLGPTDCMLPILSMNRMHA---ALAA 269
                ||:::||......||.|:.||.:|.:|:|.|...|.....|..|..|.::.:|.   ||.|
plant   232 FLDDPALIVYTSGTTGKPKGVVHTHNSINSQVRMLTEAWEYTSADHFLHCLPLHHVHGLFNALFA 296

  Fly   270 VLSVGGNVVLQQKFDGH---NAWSALLGIN-SPSKQRVTLFLAMPIVYKRLIVEYEKMFAKDSRM 330
            .|.....|....||...   ..|.....:| ..:...:|:|..:|.:|.|||..||.|   |..|
plant   297 PLYARSLVEFLPKFSVSGIWRRWRESYPVNDEKTNDSITVFTGVPTMYTRLIQGYEAM---DKEM 358

  Fly   331 VEYIVNHCRQKIRLMATAFALLPDSVFYRWREITGQNIYEYYGMMETGLVLGHPLNKRQRDSPHN 395
            .:......| |:|||.:..:.||..|.::|..|||..:.|.|||.|..:.:.:||..        
plant   359 QDSSAFAAR-KLRLMMSGSSALPRPVMHQWESITGHRLLERYGMTEFVMAMSNPLRG-------- 414

  Fly   396 GPTAVAMANNTAPNDYRPGTLGSPLKGVTARLISNKGDELITCKNELGGSVDSGLIPVEDIGGDA 460
                   |.|.       ||:|.||.||.|::   |.||     |:..|                
plant   415 -------ARNA-------GTVGKPLPGVEAKI---KEDE-----NDANG---------------- 441

  Fly   461 SLAGTIIGELQIAGSNLVSNTLANNNQEMEHKGTTNNEEQENNQDGFFKTGDICAYRNGNFYFL- 524
                  :||:.:...:|..          |:.......::...:||:|||||........:|.: 
plant   442 ------VGEICVKSPSLFK----------EYWNLPEVTKESFTEDGYFKTGDAGRVDEDGYYVIL 490

  Fly   525 -SKSSDIFTVGGYKVYGSEIKKVLISHPNINDVAVLGIPNKMWGHRLGVICIVSPDAD------- 581
             ..|:||..|||||:...||:..|:.||.:.:..|||:.:..:|..:..|.|....|.       
plant   491 GRNSADIMKVGGYKLSALEIESTLLEHPTVAECCVLGLTDNDYGEAVTAIIIAESAAKKRREDES 555

  Fly   582 ---IDLDAIKTYCYRHLPAHKCPT 602
               |.|:.:..:....|..:|.||
plant   556 KPVITLEELCGWAKDKLAPYKLPT 579

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18155NP_996360.2 CaiC 53..604 CDD:223395 150/590 (25%)
AFD_class_I 58..607 CDD:302604 149/585 (25%)
AAE13NP_001319565.1 MCS 80..597 CDD:213307 149/585 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I1727
OMA 1 1.010
OrthoDB 1 1.010 D533939at2759
OrthoInspector 1 1.000 T193469
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
55.070

Return to query results.
Submit another query.