DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18155 and acsf2

Sequence 1:NP_996360.2 Gene:CG18155 FlyBaseID:FBgn0029945 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_001038884.2 Gene:acsf2 ZFINID:ZDB-GENE-060825-7 Length:606 Species:Danio rerio

Alignment Length:607 Identity:108/608 (18%)
Similarity:207/608 (34%) Gaps:172/608 (28%)


  Fly    56 YPDEIAVKDING--EYTYFQLYMAAKR--LGIQISNICGGAALS----NVTYLCSNNALWIAIQW 112
            |||..|:..:..  ..|:.:.|...::  .|:..:.:..|..|.    |:..       |:.:|:
Zfish    79 YPDREAMVFVQDGIRKTFAEFYQDVEKAAAGLLAAGLKRGDRLGMWGPNIYE-------WVLMQF 136

  Fly   113 SCWISGQVAVPLESGQAIDQLQRQASNCKTKLLIATKEFESLAQELSQGVKSATIILDHSFLPTA 177
            :...:|.:.|.:.....:.:::......:...::...:|:|  |.....:|        ...|..
Zfish   137 ATAKAGIILVAVNPAYQLQEVEFALRKVQCNAVVCPTKFKS--QHYCDMLK--------QLCPEM 191

  Fly   178 ESVSSTSMYAKQLVAIQGVIVTENTFPNDFYSK------------------------APAMLIYT 218
            |:.|...:.:.:|..:..||||::..|..|..|                        .|..:.:|
Zfish   192 ETASPGGIKSSRLPDLHTVIVTDSQQPGSFLLKDLMQAGSSQHYQQLQDLQKKLVCDDPINIQFT 256

  Fly   219 PNAVNSPKPVLLTHRNIE-----AQMRCLIG-TWHLGPTDCMLPILSMNRMHAALAAVLSVGGNV 277
            ......||...|:|.||.     ..||  || .|......| ||:    .::....   ||||.|
Zfish   257 SGTTGKPKGATLSHHNIVNNAYFTGMR--IGYNWRKNVRIC-LPV----PLYHCFG---SVGGGV 311

  Fly   278 VL----------QQKFDGHNAWSALLGINSPSKQRVTLFLAMPIVYKRLIVEYEKMFAKDSRMVE 332
            ::          ...:||.      ..:.:..|::.|.....|.:|..::.:.:        :.:
Zfish   312 IMALYGTTVIFPSTGYDGR------ANLRAIEKEKCTFVYGTPTMYIDMLGQPD--------LAK 362

  Fly   333 YIVNHCRQKIRLMATAFALLPDSVFYRWREITG-QNIYEYYGMMETGLV--LGHPLNKRQRD--- 391
            :.::..|..|    .|.:..|..|..:...:.| :.:...||..|...|  .|.|::..:|.   
Zfish   363 FDLSSVRGGI----AAGSPCPPEVMRKILNVMGIKEMVIGYGTTENSPVTFCGFPVDSAERKIET 423

  Fly   392 ----SPHNGPTAVAMANNTAPNDYRPGTLGSPLKGVTARLISNKGDELITCKNELGGSVDSGLIP 452
                |||                            ..|:::.....|::    .||..       
Zfish   424 VGCISPH----------------------------TEAKVVDPTTGEIV----PLGAQ------- 449

  Fly   453 VEDIGGDASLAGTIIGELQIAGSNLVSNTLANNNQEMEHKGTTNNEEQENNQDGFFKTGDICAYR 517
                           |||.|.|..::          :|:........:...:|.::|||||.:. 
Zfish   450 ---------------GELMIRGYCVM----------LEYWQDEEKTRECITKDRWYKTGDIASL- 488

  Fly   518 NGNFYFL---SKSSDIFTVGGYKVYGSEIKKVLISHPNINDVAVLGIPNKMWGHRLGVICIVSPD 579
             ..|.:.   .:..|:...||..:|.:||::.|.:||.|.:..|:|:.::..|..:.....:...
Zfish   489 -DQFAYCKIEGRIKDLIIRGGENIYPAEIEQFLHTHPKILEAQVVGVKDERMGEEVCACIRLKEG 552

  Fly   580 ADIDLDAIKTYCYRHLPAHKCP 601
            .:..::.||.||...:..:|.|
Zfish   553 QECTVEEIKAYCKGKIAHYKVP 574

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18155NP_996360.2 CaiC 53..604 CDD:223395 108/608 (18%)
AFD_class_I 58..607 CDD:302604 106/606 (17%)
acsf2NP_001038884.2 PRK08315 53..606 CDD:236236 108/608 (18%)
FACL_like_2 247..597 CDD:213284 79/423 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R434
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.