DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18155 and DIP2B

Sequence 1:NP_996360.2 Gene:CG18155 FlyBaseID:FBgn0029945 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_775873.2 Gene:DIP2B HGNCID:29284 Length:1576 Species:Homo sapiens

Alignment Length:651 Identity:121/652 (19%)
Similarity:217/652 (33%) Gaps:218/652 (33%)


  Fly    64 DINGE----YTYFQLYMAAKRLGIQISNICG---------GAALSNVTYLCSNN--ALWIAIQWS 113
            |:.|:    .||.:|:..:.:|...:.|..|         |   ..|..:..||  .:::...:.
Human   360 DMTGKPVYTLTYGKLWSRSLKLAYTLLNKLGTKNEPVLKPG---DRVALVYPNNDPVMFMVAFYG 421

  Fly   114 CWISGQVAVPLE--------SGQAIDQLQRQASNCKTKLLIATKEFESLAQELSQGVKSATIILD 170
            |.::..:.||:|        .||.|..|   ..:|...|        :|..|:.  :|.      
Human   422 CLLAEVIPVPIEVPLTRKDAGGQQIGFL---LGSCGIAL--------ALTSEVC--LKG------ 467

  Fly   171 HSFLPTAESVSSTSMYAKQLVAIQG-----VIVTENTF----PNDFY------SKAPAMLIYTPN 220
               ||..::        .::|..:|     .:||::.:    |.|:.      ...||.:.|..:
Human   468 ---LPKTQN--------GEIVQFKGWPRLKWVVTDSKYLSKPPKDWQPHISPAGTEPAYIEYKTS 521

  Fly   221 AVNSPKPVLLTHRNIEAQMRCLIGTWHLGPTDCMLPILS---------------MNRMHAALAAV 270
            ...|...|.::...:.:..:.|....:....:.::.:|.               ||:|| .::..
Human   522 KEGSVMGVTVSRLAMLSHCQALSQACNYSEGETIVNVLDFKKDAGLWHGMFANVMNKMH-TISVP 585

  Fly   271 LSVGGNVVLQ--QKFDGHNAWSALLGINSPSKQRVTLFLAMPIVYKRLIVEYEKMFAKDSRMVEY 333
            .||.....|.  |:...|.|..||:                    |...:.:..|..:|.|.|..
Human   586 YSVMKTCPLSWVQRVHAHKAKVALV--------------------KCRDLHWAMMAHRDQRDVSL 630

  Fly   334 IVNHCRQKIRLMATAFALLPDSV-----FYRWREITGQNIYEYYGMMETGLVLGHPLNKRQRDSP 393
                  ..:|::.......|.||     |.        ::::.:|:....:.             
Human   631 ------SSLRMLIVTDGANPWSVSSCDAFL--------SLFQSHGLKPEAIC------------- 668

  Fly   394 HNGPTAV-AMANNTAPNDYRPGTLGSPLKGVTARLISNKG-------------DELITCKNELGG 444
               |.|. |.|...|..  |||..|:||.|  ..::|..|             :..:|.: ::|.
Human   669 ---PCATSAEAMTVAIR--RPGVPGAPLPG--RAILSMNGLSYGVIRVNTEDKNSALTVQ-DVGH 725

  Fly   445 SVDSGLIPVEDIGGDASLAGT-IIGELQIAG--SNLVSNTLANNNQEMEHKGTTNN--EEQENNQ 504
            .:..|::.:....|...|..| .|||:.::.  ..::...||         |.|.|  |....|.
Human   726 VMPGGMMCIVKPDGPPQLCKTDEIGEICVSSRTGGMMYFGLA---------GVTKNTFEVIPVNS 781

  Fly   505 DGFFKTGDICAYRNGNFYFLSKSSDIFTVGGYKVYGSEIKKVLIS--HPNINDVAVLGIP----- 562
            .| ...||:...|:|...|:...|.:|.||  |:.|    .:::|  ..|.:|:...|:.     
Human   782 AG-SPVGDVPFIRSGLLGFVGPGSLVFVVG--KMDG----LLMVSGRRHNADDIVATGLAVESIK 839

  Fly   563 ------------NKMWGHRLGVICIVSPDAD--------------ID-LDAIKTYCYRHLPAHKC 600
                        :..:..|:.|:....|||.              || :..:..||...:||:..
Human   840 TVYRGRIAVFSVSVFYDERIVVVAEQRPDASEEDSFQWMSRVLQAIDSIHQVGVYCLALVPANTL 904

  Fly   601 P 601
            |
Human   905 P 905

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18155NP_996360.2 CaiC 53..604 CDD:223395 121/652 (19%)
AFD_class_I 58..607 CDD:302604 121/652 (19%)
DIP2BNP_775873.2 DMAP_binding 14..131 CDD:283995
CaiC 336..912 CDD:223395 121/652 (19%)
AFD_class_I 360..924 CDD:302604 121/652 (19%)
AMP-binding 995..1470 CDD:278902
AFD_class_I 1012..1565 CDD:302604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.