DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18155 and dip2bb

Sequence 1:NP_996360.2 Gene:CG18155 FlyBaseID:FBgn0029945 Length:610 Species:Drosophila melanogaster
Sequence 2:XP_009300851.1 Gene:dip2bb ZFINID:ZDB-GENE-100729-4 Length:1615 Species:Danio rerio

Alignment Length:625 Identity:131/626 (21%)
Similarity:216/626 (35%) Gaps:166/626 (27%)


  Fly    64 DINGE----YTYFQLYMAAKRLGIQISNICG---------GAALSNVTYLCSNNALWIAIQWSCW 115
            ||.|:    .|:.:|:..:.:|...:.|..|         |..::.|.........|:|. :.|.
Zfish   391 DITGKPLYTLTFGKLWSRSVKLAYTLLNKLGTKNEQILKPGDRVALVYPNSDPGMFWVAF-YGCL 454

  Fly   116 ISGQVAVPLESGQAIDQLQRQASNCKTKLLIATKEFE-SLAQELS-QGV-KSAT-IILDHSFLPT 176
            ::..:.||:|    :...::.|.:.:...|:.:.... :|..|:. :|: |:.| .||.....|.
Zfish   455 LAEVIPVPIE----VPLSRKDAGSSQVGFLLGSCGVGLALTSEICLKGLPKTPTGEILQFKGWPR 515

  Fly   177 AESVSSTSMY-AKQLVAIQGVIVTENTFPNDFYSKAPAMLIYTPNAVNSPKPVLLTHRNIEAQ-- 238
            .:.|.:.|.| .|.....|..|.|.||  :..|.:..|....|...|...|..:|||....:|  
Zfish   516 LKWVVTDSKYLTKPSKDWQPHIPTANT--DTAYIEYKASKEGTVMGVAVSKVAMLTHCQALSQAC 578

  Fly   239 -------------MRCLIGTWHLGPTDCMLPILS--MNRMHAALAAVLSVGGNVVLQQKFDGHNA 288
                         .:..:|.||        .:|:  |||:|     .:||...|:.....    :
Zfish   579 NYCEGETLVNVLDFKKDMGLWH--------GVLTSVMNRIH-----TISVPYAVMKACPL----S 626

  Fly   289 WSALLGINSPSKQRVTLFLAMPIVYKRLIVEYEKMFAKDSRMVEYIVNHCRQKIRLMATAFALLP 353
            |          .|||.:..|...:.|...:.:..|..:|.|      :.....:|::..|....|
Zfish   627 W----------VQRVHIHKARVALVKCRDLHWAMMAHRDQR------DTSLASLRMLIVADGANP 675

  Fly   354 DSV-----FYRWREITGQNIYEYYGMMETGLVLGHPLNKRQRDSP-HNGPTAVAMANNTAPNDYR 412
            .||     |.        |:::.:|:            |.:...| ...|.|:.:|..      |
Zfish   676 WSVSSCDAFL--------NVFQAHGL------------KPEVICPCATSPEAMTVAIR------R 714

  Fly   413 PGTLGSPLKGVTARLISNKGDELITCKNELGGSVDSGLIPVEDIG--------------GDASLA 463
            ||..|:||.......::.....:|....|...|.    :.|:|:|              |...|.
Zfish   715 PGISGAPLPARAVLSMTGLSHGVIRVNTEDKNSA----LTVQDVGHVMPGALMCIVKPDGPPMLC 775

  Fly   464 GT-IIGELQIAGSNLVSNTLANNNQEMEHKGTTNN--EEQENNQDGFFKTGDICAYRNGNFYFLS 525
            .| .|||       :|.|:.|..|......|.|.|  |....|..| ...|:|...|:|...|:.
Zfish   776 KTDEIGE-------IVVNSRAGGNMYYGLSGVTKNTFEVIPVNASG-APIGEIPFVRSGLLGFVG 832

  Fly   526 KSSDIFTVG---------GYKVYGSEIKKVLISHPNINDV-----AVLGIPNKMWGHRLGVICIV 576
            ..|.||.||         |.:....::....::...:..|     ||..: ...:..|:.::...
Zfish   833 PGSLIFVVGKNEGLLMVSGRRHNADDLVATALAVEPVKTVYRGRIAVFSV-TVFFDERIVIVAEQ 896

  Fly   577 SPDADID---------LDAIKT------YCYRHLPAHKCP 601
            .|||..:         |.||.:      ||...:||:..|
Zfish   897 RPDASEEDSFQWMSRVLQAIDSIHQVGLYCLALVPANTLP 936

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18155NP_996360.2 CaiC 53..604 CDD:223395 131/626 (21%)
AFD_class_I 58..607 CDD:302604 131/626 (21%)
dip2bbXP_009300851.1 DMAP_binding 9..137 CDD:283995
Dip2 391..955 CDD:213273 131/626 (21%)
AFD_class_I 1052..1604 CDD:327384
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.