DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18155 and acsf3

Sequence 1:NP_996360.2 Gene:CG18155 FlyBaseID:FBgn0029945 Length:610 Species:Drosophila melanogaster
Sequence 2:XP_021329817.1 Gene:acsf3 ZFINID:ZDB-GENE-121026-3 Length:579 Species:Danio rerio

Alignment Length:572 Identity:168/573 (29%)
Similarity:270/573 (47%) Gaps:90/573 (16%)


  Fly    46 VVPTFKKAMLYPDEIAVKDINGEYTYFQLYMAAKRLGIQISN--ICGGAAL--SNVTYLCSNNAL 106
            |.|.|.:|..|.|::|:.|.:|.:||..||..:|.|...|:.  .|....|  ..:::||:|:|.
Zfish    52 VAPVFSRAPAYGDKVAIMDHSGSHTYHSLYKNSKILAGHITKALTCQSGDLQGKRISFLCANDAS 116

  Fly   107 WIAIQWSCWISGQVAVPLESGQAIDQLQRQASNCKTKLLIATKEF----ESLAQELSQGVKSATI 167
            :...||:.|:.|.:||||.....:.:|:...|:.::.||:|.:.|    |.|||:|.        
Zfish   117 YTVAQWASWMCGGIAVPLYRKHPLSELEYVISDSQSSLLVAGQSFVDTLEPLAQKLG-------- 173

  Fly   168 ILDHSFLPTAESVSSTSMYAKQLVAIQGVIVTENTFPNDF---YSKAPAMLIYTPNAVNSPKPVL 229
                  ||..:..:::|.:.           ...|.|.|.   :::.|||||||......||.||
Zfish   174 ------LPCLKLPATSSQFE-----------DTQTLPEDMISDWAERPAMLIYTSGTTGRPKGVL 221

  Fly   230 LTHRNIEAQMRCLIGTWHLGPTDCMLPILSMNRMHA---ALAAVLSVGGNVVLQQKFDGHNAWSA 291
            .||.:::|.::.|:..|.....|.:|..|.::.:|.   .|...|.||...::...|.....|..
Zfish   222 HTHSSLQAMVQGLVSEWAWHKDDVILHTLPLHHVHGIVNKLMCPLWVGATCIMLPDFSAQKVWEQ 286

  Fly   292 LLGINSPSKQRVTLFLAMPIVYKRLIVEYEKMFAKDSRMVEYIVNHCRQKIRLMATAFALLPDSV 356
            |:...||   .|.:|:|:|.:|.:||..|::.|.: .::.::|...|:::||||.:..|.||..|
Zfish   287 LICSKSP---MVNVFMAVPTIYSKLIEYYDQHFTQ-PQVQDFIRAVCKERIRLMVSGSAALPQPV 347

  Fly   357 FYRWREITGQNIYEYYGMMETGLVLGHPLNKRQRDSPHNGPTAVAMANNTAPNDYRPGTLGSPLK 421
            ..||.|||...:.|.|||.|.|:.|         .:.:.||..             ||.:|.||.
Zfish   348 LERWAEITDHVLLERYGMTEIGMAL---------SNSYKGPRV-------------PGAVGVPLP 390

  Fly   422 GVTARLISNKGDELITCKNELGGSVDSGLIPVEDIGGDASLAGTIIGELQIAGSNLVSNTLANNN 486
            ||..|::.| ...:|......|..|.:||...|             |||.:.||: |.....|..
Zfish   391 GVEVRIMMN-SSIVIAEGTSKGTQVKAGLEGKE-------------GELLVRGSS-VFQKYWNKP 440

  Fly   487 QEMEHKGTTNNEEQENNQDGFFKTGDICAYRNGNFYFLSKSS-DIFTVGGYKVYGSEIKKVLISH 550
            ||.|...|         :|.:|||||...||:|.::.:.::| ||...||||:...::::.|::|
Zfish   441 QETEESFT---------EDRWFKTGDTALYRDGVYWIMGRTSVDIIKSGGYKISALDVERHLLAH 496

  Fly   551 PNINDVAVLGIPNKMWGHRLGVICIVSPDADIDLDAIKTYCYRHLPAHKCPT 602
            |:|.||||:|.|:..||.::..:..:.....:.|..:|.:...|:.::..||
Zfish   497 PDITDVAVIGAPDATWGQKVTAVVQMRKGKTMILSDLKAWAREHMASYSIPT 548

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18155NP_996360.2 CaiC 53..604 CDD:223395 165/566 (29%)
AFD_class_I 58..607 CDD:302604 163/561 (29%)
acsf3XP_021329817.1 MCS 64..566 CDD:213307 163/561 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C321100149
eggNOG 1 0.900 E1_COG0318
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 237 1.000 Inparanoid score I3278
OMA 1 1.010
OrthoDB 1 1.010 D229996at33208
OrthoFinder 1 1.000 FOG0003173
OrthoInspector 1 1.000 T1052516
orthoMCL 1 0.900 OOG5_129266
Panther 1 1.100 LDO PTHR24096
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R434
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.