DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18155 and CG6432

Sequence 1:NP_996360.2 Gene:CG18155 FlyBaseID:FBgn0029945 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_001287502.1 Gene:CG6432 FlyBaseID:FBgn0039184 Length:674 Species:Drosophila melanogaster

Alignment Length:518 Identity:106/519 (20%)
Similarity:184/519 (35%) Gaps:147/519 (28%)


  Fly   127 GQAIDQLQRQASNCKTKLLIATKEFESLAQELSQGVKSATIILDHSFLPTAESVS---------- 181
            |.|..:|..:..:.:.||:||:          :.||:...::.....|.:|.|:|          
  Fly   167 GFAARELCSRIEHVEPKLVIAS----------NVGVEPGKVVPYLDILHSAISMSRWRPPQRNII 221

  Fly   182 ----STSMYAKQLVAIQGVI------VTENTFP--------NDFYSKAPAMLIYTPNAVNSPKPV 228
                :.|....:|..:..|:      :.|...|        ||     |..::||....:.||.|
  Fly   222 FRRDNVSPDTTKLDPLTDVLWSDILKMAEGERPIACVPIEAND-----PLYILYTSGTTDKPKGV 281

  Fly   229 LLTHRNIEAQMRCLIGTWHLGPTDCMLPILSMNRMHAALAAVLSVGGNVVLQQKFDGHN--AWSA 291
            |   |.|...:..|:.|        :..:..:|..|...||  |..|.||      ||:  .:..
  Fly   282 L---RTIGGHLVALVYT--------LRTLYGINPGHTWWAA--SDMGWVV------GHSYICYGP 327

  Fly   292 L-LGINSPSKQRVTLFLAMPIVYKRLIVEYE--KMFAKDS-----RMVEYIVNHCRQKIRLMATA 348
            | ||..|...:........|..|.|:|.:|:  .:|:..:     |..:..:::.||.......|
  Fly   328 LCLGATSVMYEGKPDRTPDPGQYFRIIDQYQVRSIFSVPTSFRVIRRADPDISYGRQYSMKSLRA 392

  Fly   349 FALLPDSVFYR---WREITGQ-NIYEYYGMMETGLVLGHPLNKRQRDSPHNGPTAVAMANNTAPN 409
            ..:..:...|.   |.|.|.: .:..::...|||..:              ..|.:....|.:|.
  Fly   393 IFIAGEHCDYETKSWIEKTFKVPVLNHWWQTETGSAV--------------TATCLGFQQNLSPP 443

  Fly   410 DYRPGTLGSPLKGVTARLISNKGDELITCKNELGGSVDSGLIPVEDIGGDASLAGTIIGELQIAG 474
            .|   :.|.||.|...:::...|.|..|  :||                     |.|..:|.:..
  Fly   444 TY---STGLPLMGYDVKILKADGSEAQT--SEL---------------------GRIALKLPLPP 482

  Fly   475 SNLVSNTLANNNQEMEHKGTTNNEE-----QENNQDGFFKTGDICAYRN--GNFYFLSKSSDIFT 532
            .|:.:              ...|||     ......|::.|.| ..|::  |..:..::..|:..
  Fly   483 GNMAT--------------LYKNEELFRTLYFQKFPGYYDTMD-AGYKDERGYIFVTARDDDVIN 532

  Fly   533 VGGYKVYGSEIKKVLISHPNINDVAVLGIPNKMWGHRLGVICIVSP-------DADIDLDAIK 588
            |.|:::..|.::..::.||::.||||.|:|....|.  ..:|:..|       ||.:..:.||
  Fly   533 VAGHRLSTSSLEDAVLRHPDVVDVAVFGVPEATKGQ--VPLCLYIPVENCKKTDAKLSTEIIK 593

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18155NP_996360.2 CaiC 53..604 CDD:223395 106/519 (20%)
AFD_class_I 58..607 CDD:302604 106/519 (20%)
CG6432NP_001287502.1 prpE 28..657 CDD:182517 106/519 (20%)
PrpE 37..651 CDD:213314 106/519 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C96764974
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.