DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18155 and CG6178

Sequence 1:NP_996360.2 Gene:CG18155 FlyBaseID:FBgn0029945 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_651221.1 Gene:CG6178 FlyBaseID:FBgn0039156 Length:544 Species:Drosophila melanogaster

Alignment Length:597 Identity:120/598 (20%)
Similarity:217/598 (36%) Gaps:170/598 (28%)


  Fly    34 RHSFDEEERSNVVVPTFKKAMLYPDEIAVKD-ING-EYTYFQLYMAAKRLGIQISNICGGAALSN 96
            |.:.|.......::..:|.   :.|...:.| :|| ||:...::.:..||...:..:  |...::
  Fly    19 RQAQDSRSLGQYILDKYKS---FGDRTVLVDAVNGVEYSASFMHKSIVRLAYILQKL--GVKQND 78

  Fly    97 VTYLCSNNALWIAIQWSCWIS-GQVAVPLESGQAIDQLQRQASNCKTKLLIATKEFESLAQELSQ 160
            |..|.|.|::..|:.....:: |....||....:..::....:..|.|::.|:|           
  Fly    79 VVGLSSENSVNFALAMFAGLAVGATVAPLNVTYSDREVDHAINLSKPKIIFASK----------- 132

  Fly   161 GVKSATIILDHSFLPTAESVSSTSMYAKQLVAIQGVIVTENTFPN-----------------DFY 208
                  |.:|.     ...|:|.:.:.|.::|:.|   |...|.|                 ||.
  Fly   133 ------ITIDR-----VAKVASKNKFVKGIIALSG---TSKKFKNIYDLKELMEDEKFKTQPDFT 183

  Fly   209 SKAP------AMLIYTPNAVNSPKPVLLTHRNIEAQMRCLIGTWHLGPTDCMLPILSMNRM---- 263
            |.|.      ::::.:......||.|.||..|:.|.:..     .:.||  ::|:..:..:    
  Fly   184 SPAANKDEDVSLIVCSSGTTGLPKGVQLTQMNLLATLDS-----QIQPT--VIPMEEVTLLTVIP 241

  Fly   264 --HA----ALAAVLSVGGNVVLQQKFDGHNAWSALLGINSPSKQRVTL-FLAMPIVYKRLIVEYE 321
              ||    .|.....||..:|...||:.....||:      .|.||.: |:..|::.        
  Fly   242 WFHAFGCLTLITTACVGARLVYLPKFEEKLFLSAI------EKYRVMMAFMVPPLMV-------- 292

  Fly   322 KMFAKDSRMVEYIVNHCRQKIRLMATAFALLPDSVFYRWREITGQ--------NIYEYYGMMETG 378
             ..||...:.:|.::      .||.......|.|     ||...|        .|.:.||:.|:.
  Fly   293 -FLAKHPIVDKYDLS------SLMVLLCGAAPLS-----RETEDQIKERIGVPFIRQGYGLSEST 345

  Fly   379 LVLGHPLNKRQRDSPHNGPTAVAMANNTAPNDYRPGTLGSPLKGVTARLISNKGDELITCKNELG 443
            |                   :|.:.|:   ...:||::|....|:.|::|               
  Fly   346 L-------------------SVLVQND---EFCKPGSVGVLKVGIYAKVI--------------- 373

  Fly   444 GSVDSGLIPVEDIGGDASLAGTIIGELQIAGSNLVSNTLANNNQEMEHKGTTNNEEQENNQDGFF 508
             ..|:|.:          |.....|||...|..::...:.:.      |.|     |...:||:.
  Fly   374 -DPDTGKL----------LGANERGELCFKGDGIMKGYIGDT------KST-----QTAIKDGWL 416

  Fly   509 KTGDICAYRNG-NFYFLSKSSDIFTVGGYKVYGSEIKKVLISHPNINDVAVLGIPNKMWGHRLGV 572
            .||||..|.:. .|:.:.:..::....||:|..:||:.:|:::..|.|.||:|.|::..|..  .
  Fly   417 HTGDIGYYDDDFEFFIVDRIKELIKYKGYQVPPAEIEALLLTNDKIKDAAVIGKPDEEAGEL--P 479

  Fly   573 ICIVSPDADIDL 584
            :..|...|::.|
  Fly   480 LAFVVKQANVQL 491

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18155NP_996360.2 CaiC 53..604 CDD:223395 117/579 (20%)
AFD_class_I 58..607 CDD:302604 117/574 (20%)
CG6178NP_651221.1 PLN02246 26..537 CDD:215137 118/591 (20%)
Firefly_Luc_like 43..529 CDD:213279 116/571 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0318
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24096
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.