DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18155 and CG11453

Sequence 1:NP_996360.2 Gene:CG18155 FlyBaseID:FBgn0029945 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_650832.1 Gene:CG11453 FlyBaseID:FBgn0038734 Length:539 Species:Drosophila melanogaster

Alignment Length:564 Identity:105/565 (19%)
Similarity:203/565 (36%) Gaps:140/565 (25%)


  Fly    66 NGEYTYFQLYMA--AKRLGIQISNICGGAALSNVTYLCSNNALWIAIQWSCWISGQVAVPLESGQ 128
            |||...|.:.:|  .|.:|::..::.|... :|.|||       :.:...|.::|.....:...|
  Fly    58 NGEAITFAIRIAQQLKAMGLKQDDVVGIVG-TNTTYL-------MPVVLGCLLNGTPFHAVSPWQ 114

  Fly   129 AIDQLQRQASNCKTKLLIAT-KEFESLAQELSQGVKSATIIL-DHSF-LPTAESV----SSTSMY 186
            ..|.::...|..:.||:... |.|:.|: .:::.:||....| ||.. :|..|.:    ::...|
  Fly   115 DEDTIKHLFSITRPKLIFCDGKCFQRLS-IIARILKSHVYTLKDHRLGMPRVEDLLEPTTAELYY 178

  Fly   187 AKQLVAIQGVIVTENTFPNDFYSKAPAMLIYTPNAVNSPKPVLLTHRNIEAQMRCLIGTWHLGPT 251
            ..:.:.:.|    ::|          ..::.|......||.|.:::      ..||.....:...
  Fly   179 VPETLLLGG----DHT----------VAILCTSGTTGLPKAVCISN------SACLFDFGFVTGQ 223

  Fly   252 DCMLPILSMNRMHAALAAVLSV--GGNVVLQQKFDGHNAWSALLGINSPSKQRVTLFLAMPIVYK 314
            |.:|...:::........:.|.  |...::..:     .::....|....|.:|||...:|    
  Fly   224 DVLLSFSTIDWSAGMFNMLFSCCHGSTRIITDR-----PYTPEYMIQLVEKYKVTLLTVVP---- 279

  Fly   315 RLIVEYEKMFAKDSRMVEYIVNHCRQKIRLMATAFALLPDSVFY-----RWRE--ITGQNIYEYY 372
                         .::...:......|.||.:..|..:.....|     :.:|  ||||..|. |
  Fly   280 -------------QQVASLLKTPTLNKQRLASIRFVSVGGGSCYVANLLKLQEFLITGQISYG-Y 330

  Fly   373 GMMETGLVLGHPLNKRQRDSPHNGPTAVAMANNTAPNDYRPGTLGSPLKGVTARLISNKGDELIT 437
            .:.|.|                    .||.....|    :|.::|..:.||..:::         
  Fly   331 ALTECG--------------------GVAANMGVA----KPSSVGRIVPGVRVKIL--------- 362

  Fly   438 CKNELGGSVDSGLIPVEDIGGDASLAGTIIGELQIAGSNLVSNTLANNNQEMEHKGTTNNEEQEN 502
              :|.|.|:..|                ..||:.:....:.:...||.|            |.:.
  Fly   363 --DEAGRSLGHG----------------ETGEILVHNGKVWNGYYANPN------------ESKR 397

  Fly   503 NQD--GFFKTGDICAYRNGNF-YFLSKSSDIFTVGGYKVYGSEIKKVLISHPNINDVAVLGIPNK 564
            .||  |:|.|||:..:.|.|: :.:.:..|:....|.:....||::|:...|::.:..|.|:.|:
  Fly   398 MQDYQGWFHTGDMGYFDNENYLHIVERKEDLLRFHGAQYSPQEIEQVIAELPDVIEACVFGLWNE 462

  Fly   565 MWGHRLGVICIVSPDADI-DLDAIKTYCYRHLPAHK---CPTVF 604
            :.|.......:..|.:.: ::|.::....|.:..||   |...|
  Fly   463 VDGDPAAAAVVKIPGSRLTEMDIVEYVAKRLVVDHKQLHCGVFF 506

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18155NP_996360.2 CaiC 53..604 CDD:223395 104/563 (18%)
AFD_class_I 58..607 CDD:302604 105/565 (19%)
CG11453NP_650832.1 CaiC 18..530 CDD:223395 105/565 (19%)
Firefly_Luc_like 46..519 CDD:213279 105/565 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0318
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24096
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.