DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18155 and CG11407

Sequence 1:NP_996360.2 Gene:CG18155 FlyBaseID:FBgn0029945 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_650831.1 Gene:CG11407 FlyBaseID:FBgn0038733 Length:538 Species:Drosophila melanogaster

Alignment Length:593 Identity:107/594 (18%)
Similarity:210/594 (35%) Gaps:139/594 (23%)


  Fly    31 EKLRHSFDEEERSNVVVPTFKKAMLYPDEIAV-----------KDINGEYTYFQLYMAAKRLGIQ 84
            ::|.:.||.......::  |.:...:|..||.           .::.....:...||  :.||:.
  Fly    19 DQLEYYFDPHLSIGEII--FNEMRRHPQLIAQISATENTILTRAELQANAMHIASYM--RSLGLL 79

  Fly    85 ISNICGGAALSNVTYLCSNNALWIAIQWSCWISGQVAVPLESGQAIDQLQRQASNCKTKLLIAT- 148
            ..:|.|..| .|.|::.       |:.::|:.:|.....|........:::..|..:..::... 
  Fly    80 QMDIVGIIA-RNTTHIS-------AVAYACFFNGIAFHSLNISYEQSTIEKLFSITRPNIIFCDG 136

  Fly   149 KEFESLAQELSQGVKSATIILDHSFLPTAESVSSTSMYAKQLVAIQGVIVTENTFP------NDF 207
            .|||.        |:|||..||...: |..:..|.|:...|:::..   :.:|..|      || 
  Fly   137 DEFEK--------VRSATAQLDVKII-TMRNHPSGSIRIDQVLSTP---IEKNFQPVRLEQGND- 188

  Fly   208 YSKAPAMLIYTPNAVNSPKPVLLTHRNIEAQMRCLIGTWH-LGPTDCMLPILSMNRMHAALAAVL 271
               ....::.:......||.|.:|:      .|.::.:.| |...|......:::.:...|..|.
  Fly   189 ---QTLAILCSSGTTGIPKAVTITN------SRQILNSSHSLTTNDVQYSHSTLDWITGLLTTVT 244

  Fly   272 SVGGNVVLQQKFDGHNAWSALLGINSPSKQRVTLFLAMPIVYKRLIVEYEKMFAKDSRMVEYIVN 336
            |                     |:.| :|:.:...:..|..:.||:.|::         :.:|: 
  Fly   245 S---------------------GVFS-TKRIIADNIFDPEFFMRLVEEHQ---------ITWII- 277

  Fly   337 HCRQKIRLMATA-FALLPDSVFYRWREITGQNIYEYYGMMETGLVLGHPLNKR-QRDSPHNGPTA 399
                    .|.| .|::.:|..:...:::....| .:|.....:...|.:..| .:|..|.....
  Fly   278 --------QAPAHMAMMVNSPSFTTSDLSSLRYY-LFGGSRASVETQHRIRSRLSKDCLHFAYGF 333

  Fly   400 VAMANNTAPN---DYRPGTLGSPLKGVTARLISNKGDELITCKNELGGSVDSGLIPVEDIGGDAS 461
            ..:.:..|.|   |.:|.::|..:.|:..::|..||                     |.:|.|. 
  Fly   334 TELGSMAALNLHFDEKPNSVGRLVAGLKLKVICEKG---------------------ESLGPDE- 376

  Fly   462 LAGTIIGELQIAGSNLVSNTLANNNQEMEHKGTTNNEEQENNQDGFFKTGDICAY--RNGNFYFL 524
                 :|||          .|.|......:.|......:..:...:|.|||: .|  .:|..|.:
  Fly   377 -----VGEL----------CLWNGQYWAGYYGNPEETHKMRDHHNWFHTGDL-GYVDDDGFIYIV 425

  Fly   525 SKSSDIFTVGGYKVYGSEIKKVLISHPNINDVAVLGIPNKMWGHRLGVICIVSPDADIDLDAIKT 589
            .:..|:........|.:||:.|:...|::.:|.|.|:.|::.|.......:....:.:....|..
  Fly   426 ERKKDMLKFQNIMYYPNEIESVISKMPDVVEVCVFGVWNEINGDEATAAVVKKRGSALTAQDIVD 490

  Fly   590 YCYRHLPA 597
            |...|:.|
  Fly   491 YVETHIDA 498

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18155NP_996360.2 CaiC 53..604 CDD:223395 103/572 (18%)
AFD_class_I 58..607 CDD:302604 102/567 (18%)
CG11407NP_650831.1 CaiC 26..523 CDD:223395 105/587 (18%)
Firefly_Luc_like 47..522 CDD:213279 101/564 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0318
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24096
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.