DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18155 and CG11391

Sequence 1:NP_996360.2 Gene:CG18155 FlyBaseID:FBgn0029945 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_650830.1 Gene:CG11391 FlyBaseID:FBgn0038732 Length:542 Species:Drosophila melanogaster

Alignment Length:596 Identity:110/597 (18%)
Similarity:222/597 (37%) Gaps:145/597 (24%)


  Fly    34 RHS-FDEEERSNVVVPTFKKAMLYPD---EIAVKDINGEYTYFQLYMAAKRLGIQISNICGGAAL 94
            ||| ::||.....::  |::....|.   :|:..| |...|.||:...|.::|..:.: .|....
  Fly    24 RHSLYNEELTVGQII--FRQLQRQPQRIFQISHTD-NTRLTRFQMLQNAAKIGCYLRD-QGFKKE 84

  Fly    95 SNVTYLCSNNALWI-AIQWSCWISG---QVAVPLESGQAIDQLQRQASNCKTKLLIA-TKEFESL 154
            :::..|.:.|:..: |:.:.|..:|   ....|......|..|.:..   :.::|.. |.::|.:
  Fly    85 TDLVGLMARNSTHVGALAYGCLFNGTPFHAVNPNLEHNTISSLYKIT---RPRILCCDTADYEKI 146

  Fly   155 AQELSQGVKSATIILDHSFLPTAESVSSTSMYAKQLVAIQGVIVTENTFPNDFYSKAPAM----- 214
             :::...: .|.||..:..||...||:.               :.:|..|:|:   .||.     
  Fly   147 -KDIGASL-GALIITVNGKLPGVISVAD---------------ILQNPLPDDY---EPAQFQRGV 191

  Fly   215 -----LIYTPNAVNSPKPVLLTHRNIEAQMRCLIGTWHLGPTDCMLPILSMNRMHAALAAV-LSV 273
                 ::.:.....:||.|.|::.....:|..     :||..|......:::.:...:..| .:|
  Fly   192 DRTMAILCSSGTTGTPKAVTLSNSRKLFEMHS-----YLGSDDVQYAPSTLDWLTGLITLVTAAV 251

  Fly   274 GGNV--VLQQKFDGHNAWSALLGINSPSKQRVTLFLAMPIVYKRLIVEYEKMFAKDSRMVEYIV- 335
            .|.|  :..:.|    :.:..|.|   .:|....:..|...:..::....|..|:..|.::::: 
  Fly   252 FGTVRLISSEMF----STAHFLDI---CEQHEVSWTIMANSHVAMLANCPKTSAQKLRSLKHLLF 309

  Fly   336 --NHCRQKIRLMATAFALLPDSVFYRWREITGQNIY-EYYGMMETGLVLGHPLNKRQRDSPHNGP 397
              .||     |:||   |.....|     :.|..|. ..||:.|.|.::.:..:.:.:      |
  Fly   310 AGGHC-----LVAT---LKKMQSF-----LHGSGILRNAYGLTEVGTLVSYNYDTQSK------P 355

  Fly   398 TAVAMANNTAPNDYRPGTLGSPLKGVTARLISNKGDELITCKNELGGSVDSGLIPVEDIGGDASL 462
            |:|                        .||::|...:::....:|.|  ..||            
  Fly   356 TSV------------------------GRLMANIRVKIVDSSGQLQG--PKGL------------ 382

  Fly   463 AGTIIGELQIAGSNLVSNTLANNNQEMEHKGTTNNEEQENNQDGFFKTGDICAYRNGNF-YFLSK 526
             |.|:.......|..|.|.||  ..||            .:..|::.|||:..:...:: :.:.:
  Fly   383 -GEILCHNGQPWSGYVGNPLA--TAEM------------RDSAGWYHTGDVGYFDEDHYLHIVER 432

  Fly   527 SSDIFTVGGYKVYGSEIKKVLISHPNINDVAVLGIPNKMWGHRLGVICIVSPDADIDLDAIKTYC 591
            ..|:....|...|..|:::|:...|::.:|.|.||..:..|.......::...:.:|...::.|.
  Fly   433 KKDMLKYLGMMYYPHEVEEVIAQMPDVAEVCVFGIFRETEGDAAAASVVLRSGSKLDPKHVEQYV 497

  Fly   592 -------YRHL 595
                   ::||
  Fly   498 RKNVSVQFKHL 508

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18155NP_996360.2 CaiC 53..604 CDD:223395 104/577 (18%)
AFD_class_I 58..607 CDD:302604 103/572 (18%)
CG11391NP_650830.1 CaiC 24..541 CDD:223395 110/597 (18%)
AFD_class_I 51..527 CDD:302604 103/568 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0318
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24096
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.