DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acsf3 and Acsx2

DIOPT Version :10

Sequence 1:NP_996360.2 Gene:Acsf3 / 31668 FlyBaseID:FBgn0029945 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_650830.1 Gene:Acsx2 / 42353 FlyBaseID:FBgn0038732 Length:542 Species:Drosophila melanogaster


Alignment Length:36 Identity:10/36 - (27%)
Similarity:18/36 - (50%) Gaps:1/36 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 STITQTPSTIVGSGIPLNYAG-LSLIVIPLITLLGN 55
            ||.|....:|...|:||.::| ..::.:|...:..|
  Fly    25 STATGFIMSICFFGLPLMWSGFFKVMQVPAAIVCSN 60

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acsf3NP_996360.2 Adenylate forming domain, Class I superfamily 58..603 CDD:473059
Acsx2NP_650830.1 Firefly_Luc_like 51..527 CDD:341237 2/10 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.