DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18155 and CG11659

Sequence 1:NP_996360.2 Gene:CG18155 FlyBaseID:FBgn0029945 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_650829.1 Gene:CG11659 FlyBaseID:FBgn0038731 Length:546 Species:Drosophila melanogaster

Alignment Length:600 Identity:115/600 (19%)
Similarity:209/600 (35%) Gaps:159/600 (27%)


  Fly    35 HSFDEEERSNVVVPTFKKAMLYPDEIAVK----DIN-GEYTYFQLYMAAKRLGIQISNICG---- 90
            :|:|.:::            ::..|..||    |:: ||..:.:: ....:|..|||...|    
  Fly     7 NSYDNDQK------------IWSGEPVVKYFDPDLSIGEIIFHEM-RRHPQLTAQISATEGTVLT 58

  Fly    91 -GAALSNVTYLCS------------------NNALWIAIQWSCWISGQVAVPLESGQAIDQLQRQ 136
             |..|:|...|.|                  |....:|:.::|:.:|.....|......|.:::.
  Fly    59 RGELLANAMRLASYMRSLGLLQSDIVGLIGRNTTHMLAVAYACFFNGIAFHSLNITYDRDTIEKI 123

  Fly   137 ASNCKTKLLIAT-KEFESLAQELSQGVKSATIILDHSFLPTAESVSSTSMYAKQLVAIQGVIVTE 200
            ....:..::... .|||.        |:|||..||...: |..:....|:...::||..   :.|
  Fly   124 YKVTRPSIIFCDGDEFEK--------VRSATAELDVKIV-TMRNHPLDSIKIDEVVATP---IEE 176

  Fly   201 NTFP------NDFYSKAPAMLIYTPNAVNSPKPVLLTH-RNIEAQMRCLIGTWHLGPTDCMLPIL 258
            |..|      ||    ....::.:.....:||.|.:|: |:|      |.|.:||...|..   .
  Fly   177 NFQPAKLEKGND----QTLAILCSSGTTGTPKAVTITNSRHI------LAGNYHLTTADVQ---Y 228

  Fly   259 SMNRMHAALAAVLSVGGNVVLQQKFDGHNAWSALLGINSPSKQRVTLFLAMPIVYKRLI--VEYE 321
            |.|.:......:.::...|....:....||:.....:....:.:||..:..|.....:|  .::|
  Fly   229 SHNTLDWITGLLTTITSGVFSTTRIIADNAFDPAFALRIIEEYKVTWTIQPPSSMALMINCPDFE 293

  Fly   322 KMFAKDSRMVEYIVNHCRQKIRLMATAFALLPDSVFYRWREITGQNIYEY-YGMMETGLVLGHPL 385
            .......|.  |:....|..:.:....            |.....|..:: ||..|.|       
  Fly   294 TCDLSSLRC--YMFGGSRAALEVQKGI------------RSRLSHNCLQFVYGFTELG------- 337

  Fly   386 NKRQRDSPHNGPTAVAMANNTAPNDYRPGTLGSPLKGVTARLISNKGDELITCKNELGGSVDSGL 450
                           |||......|.:.|::|..:.|:..::           ||:.|       
  Fly   338 ---------------AMATINCHFDEKTGSVGQLVNGLKMKI-----------KNDDG------- 369

  Fly   451 IPVEDIGGDASLAGTIIGELQIAGSNLVSNTLANNNQEMEHKGTTNNE-EQENNQD--GFFKTGD 512
               |.:|.|.      |||:.|.           |||..  .|...|| |..|.:|  |::.:||
  Fly   370 ---ESLGPDE------IGEVCIM-----------NNQHW--SGYYGNEVETRNMRDSLGWYHSGD 412

  Fly   513 ICAY--RNGNFYFLSKSSDIFTVGGYKVYGSEIKKVLISHPNINDVAVLGIPNKMWGHRLGVICI 575
            : .|  |:|..|.:.:..::........|.::|:.|:...|.:.:|.|.||.:.::|.......:
  Fly   413 L-GYMDRDGFLYIMDRKKEMLKYQNIMYYPNDIESVISEMPQVAEVCVFGIWSNIFGDEAAAAVV 476

  Fly   576 VSPDADIDLDAIKTY 590
            ....::::...:..|
  Fly   477 KKLGSELEAQDVVDY 491

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18155NP_996360.2 CaiC 53..604 CDD:223395 113/582 (19%)
AFD_class_I 58..607 CDD:302604 113/577 (20%)
CG11659NP_650829.1 CaiC 26..523 CDD:223395 110/569 (19%)
AFD_class_I 47..522 CDD:302604 106/547 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0318
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24096
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.