DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18155 and dip2ba

Sequence 1:NP_996360.2 Gene:CG18155 FlyBaseID:FBgn0029945 Length:610 Species:Drosophila melanogaster
Sequence 2:XP_009295115.1 Gene:dip2ba ZFINID:ZDB-GENE-040426-2305 Length:1587 Species:Danio rerio

Alignment Length:629 Identity:127/630 (20%)
Similarity:204/630 (32%) Gaps:174/630 (28%)


  Fly    64 DINGE----YTYFQLYMAAKRLGIQISNICG---------GAALSNVTYLCSNNALWIAIQWSCW 115
            ||.|:    .||.:|:..:.:|...:.|..|         |..::.|.........|:|. :.|.
Zfish   363 DITGKPLYTLTYGKLWSRSLKLAYTLLNKLGTKNEPVLKPGDRVALVYPNSDPGMFWVAF-YGCL 426

  Fly   116 ISGQVAVPLE-----SGQAIDQLQRQASNCKTKLLIATKEFESLAQELSQGVKSATIILDHSFLP 175
            ::..:.||:|     ......|:.....:|...|.:.::.......:...|.     |:.....|
Zfish   427 LAEVIPVPIEVPLSRKDAGSQQIGFLLGSCGVGLALTSEVCLKGLPKTPNGE-----IMQFKGWP 486

  Fly   176 TAE-SVSSTSMYAKQLVAIQGVIVTENTFPNDFYSKAPAMLIYTPNAVNSPKPVLLTHRNIEAQM 239
            ..: .|:.|....|.....|..|.|.||  :..|.:..|....|...|...|..:|||.....|.
Zfish   487 RLKWVVTDTKYLTKPSKDWQPHIPTANT--DTAYIEYKASKEGTVMGVAVSKISMLTHCQALTQA 549

  Fly   240 ------RCLI---------GTWHLGPTDCMLPILS--MNRMHAALAAVLSVGGNVVLQQKFDGHN 287
                  ..|:         |.||        .:|:  |||:|     .:||...|:.....    
Zfish   550 CNYCEGETLVNVLDFKKDSGLWH--------GVLTSVMNRIH-----TISVPYAVMKACPL---- 597

  Fly   288 AWSALLGINSPSKQRVTLFLAMPIVYKRLIVEYEKMFAKDSRMVEYIVNHCRQKIRLMATAFALL 352
            :|          .|||.:..|...:.|...:.:..|..:|.:....      ..:|::..|....
Zfish   598 SW----------VQRVHVHKARVALVKCRDLHWAMMAHRDQKDTNL------SSLRMLIVADGAN 646

  Fly   353 PDSV-----FYRWREITGQNIYEYYGMMETGLVLGHPLNKRQRDSP-HNGPTAVAMANNTAPNDY 411
            |.||     |.        |:::.:|:            |.:...| .:.|.|:.:|..      
Zfish   647 PWSVSSCDAFL--------NVFQSHGL------------KPEMICPCASSPEAMTVAIR------ 685

  Fly   412 RPGTLGSPLKGVTARLISNKGDELITCKNELGGSVDSGLIPVEDIG--------------GDASL 462
            |||..|:||.......::.....:|....|...|.    :.|:|:|              |...|
Zfish   686 RPGAPGTPLPARAILSMAGLSHGVIRVNTEDKNSA----LTVQDVGHVMPGALMCIVKPDGPPML 746

  Fly   463 AGT-IIGELQIAGSNLVSNTLANNNQEMEHKGTTNNE-EQENNQDGFFKTGDICAYRNGNFYFLS 525
            ..| .|||       :|.|:.|.........|.|.|. |......|....||:...|.|...|:.
Zfish   747 CKTDEIGE-------IVLNSRAGGTMYYGLPGVTKNTFEVIPVNSGGTPIGDVPFTRTGLLGFVG 804

  Fly   526 KSSDIFTVGGYKVYGSEIKKVLISHPNIND------------------VAVLGIPNKMWGHRLGV 572
            ..|.:|.||  |:.|  :..|.....|.:|                  :||..: ...:..|:.:
Zfish   805 PGSLVFVVG--KIEG--LLSVSGRRHNADDLVATALAVEPVKTVYRGRIAVFSV-TVFYDERVVI 864

  Fly   573 ICIVSPDADID---------LDAIKT------YCYRHLPAHKCP 601
            :....|||:.:         |.||.:      ||...:||:..|
Zfish   865 VAEQRPDANEEDSFQWMSRVLQAIDSIHQVGLYCLALVPANTLP 908

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18155NP_996360.2 CaiC 53..604 CDD:223395 127/630 (20%)
AFD_class_I 58..607 CDD:302604 127/630 (20%)
dip2baXP_009295115.1 DMAP_binding 8..124 CDD:283995
CaiC 339..915 CDD:223395 127/630 (20%)
Dip2 363..927 CDD:213273 127/630 (20%)
AMP-binding 1007..1481 CDD:278902
Dip2 1024..1576 CDD:213273
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.