DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18155 and AcCoAS

Sequence 1:NP_996360.2 Gene:CG18155 FlyBaseID:FBgn0029945 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_001014599.2 Gene:AcCoAS FlyBaseID:FBgn0012034 Length:670 Species:Drosophila melanogaster

Alignment Length:537 Identity:99/538 (18%)
Similarity:185/538 (34%) Gaps:178/538 (33%)


  Fly   113 SCWISGQVAVPLESGQAIDQLQRQASNCKTKLLI--------------------ATKEFESLAQE 157
            :|...|.|...:.:|.:.|.|..:..:||.||||                    |.::.|.:...
  Fly   159 ACARIGAVHSIVFAGFSPDSLAERMFDCKAKLLITADGAWRGEKPLYLKALCDTALEKVEEMGHS 223

  Fly   158 LSQGVKSATIILDHSFLPTAESVSSTSMYAKQLVAIQGVIVTEN---TFPNDFY----------- 208
            :.:     .|::.|               .|::...|...|.|.   |...|::           
  Fly   224 VEK-----CIVVSH---------------LKRVTPCQPDHVEEEIPWTDDRDYWWHEEMEDKEPA 268

  Fly   209 -------SKAPAMLIYTPNAVNSPKPVLLTHRNIEAQMRCLIGT--------------------- 245
                   ::.|..::||..:...||.||.|    .|.......|                     
  Fly   269 CYPEWMDAEDPLFMLYTSGSTGKPKGVLHT----TAGYLLYAATTFKIVFDYKPGDIYWCTGDVG 329

  Fly   246 WHLGPTDCMLPILSMNRMHAALAAVLSVGGNVVLQQK--FDGHNA-WSALLGINSPSKQRVTLFL 307
            |..|.|            :.....:.:...:|:.:..  |.|::. ||.:      .|.:||.|.
  Fly   330 WITGHT------------YVVYGPLANGATSVIFEGTPFFPGNDRYWSVI------DKYKVTQFY 376

  Fly   308 AMPIVYKRLIVEYEKMFAKDSRMVEYIVNHCRQKIRLM-ATAFALLPDSVFYRWREITGQ--NIY 369
            ..|...:.|:     .|.:..     ::.|....:::: :....:.|::..:.::.|..:  :|.
  Fly   377 TAPTAIRALM-----KFGEGP-----VLKHNLSGLKVLGSVGEPINPEAWLWYYKYIGKEQCSIV 431

  Fly   370 EYYGMMETGLVLGHPLNKRQRDSPHNGPTAVAMANNTAPNDYRPGTLGSPLKGVTARLISNKGDE 434
            :.:...|||   ||.:      :|..|.|.:           :||:...|..||...|:    ||
  Fly   432 DTFWQTETG---GHVI------TPLPGATPM-----------KPGSASFPFFGVKPTLL----DE 472

  Fly   435 LITCKNELGGSVDSGLIPVEDIGGDASLAGTIIGELQIAGSNLVSNTLANNNQEMEHKGTTNNEE 499
               |..|:.|..:..|:..:...|                   :..||.||::..|       :.
  Fly   473 ---CGIEIKGEGEGYLVFSQPWPG-------------------MMRTLYNNHERFE-------DT 508

  Fly   500 QENNQDGFFKTGDICAYR--NGNFYFLSKSSDIFTVGGYKVYGSEIKKVLISHPNINDVAVLGIP 562
            ..:...|::.||| .|.|  :|..:...:..|:..|.|:.:..:|::.||..||.:.:.||:..|
  Fly   509 YFSKFPGYYCTGD-GARRDADGYLWITGRVDDMLNVSGHLMSTAEVESVLTEHPRVAESAVVSRP 572

  Fly   563 NKMWGHRLGVICIVSPD 579
            :.:.|..|  .|.::|:
  Fly   573 HPVKGECL--YCFITPN 587

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18155NP_996360.2 CaiC 53..604 CDD:223395 99/538 (18%)
AFD_class_I 58..607 CDD:302604 99/538 (18%)
AcCoASNP_001014599.2 PRK00174 7..665 CDD:234677 99/538 (18%)
ACS 30..654 CDD:213313 99/538 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C96741131
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.