DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18155 and CG18586

Sequence 1:NP_996360.2 Gene:CG18155 FlyBaseID:FBgn0029945 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_647993.2 Gene:CG18586 FlyBaseID:FBgn0035642 Length:545 Species:Drosophila melanogaster

Alignment Length:571 Identity:110/572 (19%)
Similarity:203/572 (35%) Gaps:166/572 (29%)


  Fly    74 LYMAAKRLGIQISNICGGAALSNVTYLCSNNAL-WIAIQWSCWISGQVAVPLESGQAIDQLQRQA 137
            |:|.|.|:...:.|:  |...:::..:...:.. ..|:.::|:.:|   .||   .|:.....:|
  Fly    70 LHMNAMRVASYMRNM--GLGQTDIVGVMGRHTTHQSAVAYACFFNG---TPL---HALHNAYEEA 126

  Fly   138 SNCKTKLLIATK---------EFESLAQELSQGVKSATIILDHSFLPTAESVSSTSM--YAKQLV 191
              |..||...||         |:|.        |||||..|         .|:..:|  :.:..|
  Fly   127 --CIAKLFGITKPRLIFCDGDEYEK--------VKSATKDL---------QVTIVTMRNHPRGSV 172

  Fly   192 AIQGVIVT---ENTFP---NDFYSKAPAMLIYT-----PNAV---NSPKPVL----LTHRNIEAQ 238
            .||.|:.|   :|..|   .|......|:|..:     |.||   ||.|.::    :.:.||:..
  Fly   173 RIQDVLTTPVMQNFQPLRLKDGIDHTLAILSSSGTSGFPKAVTISNSHKIIVDYMAINNSNIQYT 237

  Fly   239 MRCLIGTWHLGPTDCMLPILSMNRMHAALAAVLSVGGNVVLQQKFDGHNAWSALLGINSPSKQRV 303
            ...|  .|..|        |||    |..:.|.|. .:::....||                   
  Fly   238 SSTL--DWCSG--------LSM----AITSGVFST-TSIIADCDFD------------------- 268

  Fly   304 TLFLAMPIVYKRLIVEYEKMFAKDSRMVEYIVNHCRQKIRLMATAF-ALLPDSVFYRWREITGQN 367
                  |.::.|.|.:|                  |..:.|::::: |:..:...:...:::..|
  Fly   269 ------PGLFCRAIGKY------------------RISMVLLSSSYLAIFANCPEFESADLSSLN 309

  Fly   368 IYEYYGMMETGLVLGHPLNKRQRDSPHN---GPTAVAMANNTAPN-DYRPGTLGSPLKGVTARLI 428
             |..:|.....|.:...:..|......|   |.|.:..|.:...| |.:|.::|..::|:..::|
  Fly   310 -YVIFGGSSCSLEVQRKVRSRLSHDCLNFCYGLTELNSAGSVNLNFDEKPNSVGRAIRGIKIKVI 373

  Fly   429 SNKGDELITCKNELGGSVDSGLIPVEDIGGDASLAGTIIGELQIAGSNLVSNTLANNNQEMEHKG 493
            ..:|:                           :....::||:....|...:....|.::      
  Fly   374 DEQGE---------------------------AQEPNVVGEICFHNSQKWAGYYKNPDE------ 405

  Fly   494 TTNNEEQENNQDGFFKTGDICAY--RNGNFYFLSKSSDIFTVGGYKVYGSEIKKVLISHPNINDV 556
            |...::.||    :..|||: .|  ::|..:.:.:..|:........|.|||:.|:...||:.:.
  Fly   406 TRQIQDSEN----WIHTGDL-GYVDKDGYLFVIDRLKDMLKYQNIMYYPSEIENVIAEMPNVLEA 465

  Fly   557 AVLGIPNKMWGHRLGVICIVSPDADIDLDAIKTYCYRHLPAHKCPTVFKTL 607
            .|.||.:.:.|.......:..|...::...:..|..:.:.|.     ||.|
  Fly   466 CVFGIWDPVNGDEAAASLVKKPGTQLEAQDVVEYVRKRITAK-----FKQL 511

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18155NP_996360.2 CaiC 53..604 CDD:223395 107/567 (19%)
AFD_class_I 58..607 CDD:302604 109/570 (19%)
CG18586NP_647993.2 CaiC 35..541 CDD:223395 110/572 (19%)
AFD_class_I 55..530 CDD:302604 110/572 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0318
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24096
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.