DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18155 and CG5568

DIOPT Version :9

Sequence 1:NP_996360.2 Gene:CG18155 / 31668 FlyBaseID:FBgn0029945 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_647992.1 Gene:CG5568 / 38658 FlyBaseID:FBgn0035641 Length:545 Species:Drosophila melanogaster


Alignment Length:641 Identity:119/641 - (18%)
Similarity:230/641 - (35%) Gaps:206/641 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KLRHSFDE--------EERS---------NVVVPTFKKAMLYPDEIAVKDINGEYTYFQL----- 74
            |.|::|||        |:||         .::....::..:...:|:|.: |.|.|:..:     
  Fly    12 KTRNTFDENLKIWSGGEKRSLFSPDLSIGEIIFQQMERNAMLTAQISVTE-NTELTWKDIQTNAM 75

  Fly    75 ----YMAAKRLGIQISNICG--GAALSNVTYLCSNNALWIAIQWSCWISGQVAVPLESGQAIDQL 133
                ||  ::||::..:..|  |...:::|          |:.::|:.:|.....|.:......:
  Fly    76 KVASYM--RKLGLEQGDFVGVIGRLTTHLT----------ALAYACFFNGTPYHALHTEYEQSAI 128

  Fly   134 QRQASNCKTKLLIAT-KEFESLAQELSQGVK---------SATIILDHSFLPTAESVSSTSMYAK 188
            :|.....|.:|:... .|||.: |..::|::         .|.|:.....|.|...::...:..|
  Fly   129 ERLFGITKPRLIFCDGDEFEKV-QAATKGLQVQIVTMRNHPAGILRIQDILTTPVEMNFRPVRLK 192

  Fly   189 ----QLVAIQG-----------VIVTENTFPNDFYSKAPAMLIYTPNAVNSPKPVLLTHRNIEAQ 238
                ||:||..           .|...:.....|.....:::.|.||.::               
  Fly   193 DGTDQLLAILSSSGTSGLPKAVTISNSHQIIGSFLPVDSSIIQYNPNTLD--------------- 242

  Fly   239 MRCLIGTWHLGPTDCMLPILSMNRMHAALAAVLSVGGNVVLQQKFDGHNAWSALLGINSPSKQRV 303
                   |..|.|      :::|      |||.|: .:::....||..|    |.|:  ..|.|:
  Fly   243 -------WASGIT------MTIN------AAVFSL-TSIIEDCDFDPAN----LCGL--IEKYRI 281

  Fly   304 TLFLAMPIVYKRLIVEYEKMFAKDSRMVEYIVNHCRQKIRLMATAFALLPDSVFYRWREITGQNI 368
            ::                 :|...|::.  ::::|.:                ||. .:::... 
  Fly   282 SM-----------------VFVSSSQLA--MLSNCPE----------------FYA-ADLSSVK- 309

  Fly   369 YEYYGMMETGLVLGHPLNKRQRDSPHNGPTAVAMANNTAPN------DYRPGTLGSPLKGVTARL 427
            |.:||.....|.:.:.:..|..:...|....:...|  :|.      |.:|.::|.|::|:..::
  Fly   310 YFFYGGSNCSLEVQNKIRSRLSNECVNFSYTLTELN--SPGCLNFNFDEKPNSVGRPVRGIQIKI 372

  Fly   428 ISNKGDELITCKNELGGSVDSGLIPVEDIGGDASLAGTIIGELQIAGSNLVSNTLANNNQEME-- 490
            :           ||||                           :..|.|:|.....||.|:..  
  Fly   373 V-----------NELG---------------------------EAQGPNVVGEICFNNGQKWPGY 399

  Fly   491 HKGTTNNEEQENNQD--GFFKTGDICAY--RNGNFYFLSKSSDIFTVGGYKVYGSEIKKVLISHP 551
            :|   |.||.:..||  .:|.|||: .|  .:|..:.:.:..|:........|.|||:.|:...|
  Fly   400 YK---NPEETKKMQDSENWFHTGDL-GYMDEDGYLFIIDRLKDMLKYQTIMYYPSEIESVIAEMP 460

  Fly   552 NINDVAVLGIPNKMWGHRLGVICIVSPDADIDLDAIKTYCYRHLPAHKCPTVFKTL 607
            |:.:..|.||.:.::|.:.....:......::...:..|..:.:||.     ||.|
  Fly   461 NVVEACVFGIWDPVYGDKAAASVVKKQGTQLEAQDVVEYVRKRIPAK-----FKQL 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18155NP_996360.2 CaiC 53..604 CDD:223395 108/598 (18%)
AFD_class_I 58..607 CDD:302604 110/596 (18%)
CG5568NP_647992.1 CaiC 35..540 CDD:223395 111/618 (18%)
Firefly_Luc_like 55..530 CDD:213279 111/598 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0318
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24096
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.