DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18155 and CG4563

Sequence 1:NP_996360.2 Gene:CG18155 FlyBaseID:FBgn0029945 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_611913.1 Gene:CG4563 FlyBaseID:FBgn0035006 Length:537 Species:Drosophila melanogaster

Alignment Length:547 Identity:96/548 (18%)
Similarity:177/548 (32%) Gaps:185/548 (34%)


  Fly   114 CWISGQVAVPLESGQAIDQLQRQASNCKTKLLIATKEFESLAQELSQGV--KSATIILDHSFLPT 176
            ||.:..:.:..:.|..:......|...:..|...:   |.|.||...|:  .|:|.::.   :.|
  Fly    43 CWPTNVIQITDDDGTVLTNADMLAYATRIALFFKS---EGLTQEDRVGIIANSSTFVIP---VAT 101

  Fly   177 AESVSSTSM----YAKQLVAIQGVI--------------------VTENTFP------------- 204
            |....:|..    |:::...:||:.                    :|:...|             
  Fly   102 ACFFQATPFHAVNYSREPAIVQGLYSVTKPKIMFIDGPDYDRIKEITKEWSPKLITLTGKVEGVT 166

  Fly   205 --NDFYSKAPAMLIYTPNAVNS-----------------PKPVLLTHRNIEAQMRCLIGT----- 245
              .|.....||..||.|.::.:                 ||.|.|:||:|.:.....|.|     
  Fly   167 SIEDLVKPHPAEKIYVPASLATGGDQIAVVLCSSGTAGLPKAVALSHRHIASTNSLCISTDVLYT 231

  Fly   246 -----WHLGPTDCMLPILSMNRMHAALAAVLSVGGNVVLQQKFDGHNAWSALLGINSPSKQRVTL 305
                 |..|     ..|..||         |:.|...::.::     .:||...:...||.:||.
  Fly   232 SATIDWMTG-----FSITVMN---------LTCGFTRIISRR-----TFSAETALYLVSKYKVTC 277

  Fly   306 FLAMP----IVYKRLIVEYEKMFAKDSRMVEYIVNHCRQKIRLMATAFALLPDSVFYRWREITGQ 366
            ....|    .::...:...|::   :|..:.:::... ..:.|:..|..|||.:.          
  Fly   278 LAMAPWQAYELFTSPLATSEQL---ESLKIAFVIGGW-ISLALLRRAQELLPKTY---------- 328

  Fly   367 NIYEYYGMMETGLV---LGHPLNKRQRDSPHNGPTAVAMANNTAPNDYRPGTLGSPLKGVTARLI 428
             :...||..|||:|   :.|.|.              ......||             |:..::.
  Fly   329 -VMFSYGTTETGVVTINIDHSLE--------------CSVGRLAP-------------GMRIKIQ 365

  Fly   429 SNKGDELITCKNELGGSVDSGLIPVEDIGGDASLAGTIIGELQIAGSNLVSNTLANNNQEMEHKG 493
            ...|.:|        |...:|.:.: |||                               ::.:|
  Fly   366 GEDGQQL--------GVNQTGEVLI-DIG-------------------------------LKWEG 390

  Fly   494 TTNNEEQENN--QDGFFKTGDICAY-RNGNFYFLSKSSDIFTVGGYKVYGSEIKKVLISHPNIND 555
            ..:|.|....  |||:...||:..: .:.|.|.:.:..|:........:.:||::::...|.:..
  Fly   391 YLSNPEDTATTLQDGWINLGDLGYFDEDNNLYLVDRKKDLLKYKSKHYWPNEIEQIIAELPEVEH 455

  Fly   556 VAVLGIPNKMWGHRLGVICIVSPDADI 582
            |.|:|:.:..:|...|.:.|....|:|
  Fly   456 VCVVGVRDARYGDAAGALIIKKEGAEI 482

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18155NP_996360.2 CaiC 53..604 CDD:223395 96/548 (18%)
AFD_class_I 58..607 CDD:302604 96/548 (18%)
CG4563NP_611913.1 CaiC 21..531 CDD:223395 96/548 (18%)
Firefly_Luc_like 49..521 CDD:213279 94/542 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0318
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24096
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.