DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18155 and CG9993

Sequence 1:NP_996360.2 Gene:CG18155 FlyBaseID:FBgn0029945 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_611518.1 Gene:CG9993 FlyBaseID:FBgn0034553 Length:543 Species:Drosophila melanogaster

Alignment Length:537 Identity:104/538 (19%)
Similarity:191/538 (36%) Gaps:130/538 (24%)


  Fly    55 LYPDEI-AVKDING-EYTYFQLYMAAKRLG-------IQISNICGGAALSNVTYLCSNNALWIAI 110
            ||.|:: .|.|..| |.|..||...::||.       :|..::.|.:| .|.|||..       :
  Fly    38 LYSDKVMQVYDPTGEELTGSQLLEQSRRLAHAFQRLKLQRGDVVGISA-KNTTYLTE-------V 94

  Fly   111 QWSCWISGQVAVPLESGQAIDQLQRQASNCKTKLLIATKEFESLAQELSQGVKSAT-IILDHSFL 174
            ..:..::|....||......:.........|.|::....:.......:...:|..| |||....|
  Fly    95 VIAALLNGTPINPLHPDFDAETTAYMFEITKPKVIFCDLDNYQTLSAVKSSLKFKTEIILLTGTL 159

  Fly   175 PTAESVSS------TSMYAKQLVAIQGVIVTENTFPNDFYSKAPAMLIYTPNAVNSPKPVLLTHR 233
            |...::..      |....|.|.|...:...:..|           :|.:......||.|..:||
  Fly   160 PGVRNIQDLLADGCTGYDEKTLFACPHLCGDDTAF-----------IITSSGVTGLPKGVTRSHR 213

  Fly   234 NI--EAQMRCLIGTWHLGPTD----CMLPILSMNRMHAALAAVLSVGGNVVLQQKFDGHNAWSAL 292
            ::  .|::.      .|..:|    |..|:..::.:...||::::....::..:.|      |..
  Fly   214 SLLNSAKIP------QLFTSDTVLFCFSPLYWISCIFTLLASLVNGCRRIITNRPF------SVA 266

  Fly   293 LGINSPSKQRVTLFLAMPIVYKRLIVEYEKMFAKDSRMVEYIVNHCRQKIRLMATAFALLPDSVF 357
            ...:...:.:|:..|.:|        .:..:.||.....|....  .|.::....:.:.:|..::
  Fly   267 YFADLVERHQVSFVLTVP--------HHMALLAKSPERQELAAK--MQCVQSFVCSGSKVPMGIW 321

  Fly   358 YRWREITGQNIYE-YYGMMETGLV---LGHPLNKRQRDSPHNGPTAVAMANNTAPNDYRPGTLGS 418
            .:..|:.|.|.:. .||:.|||.:   :|.||                            |:.|.
  Fly   322 RQLYELLGANRFAVLYGLTETGGISKNVGGPL----------------------------GSEGR 358

  Fly   419 PLKGVTARLISNKGDELITCKNELGGSVDSGLIPVEDIGGDASLAGTIIGELQIAGSNLVSNTLA 483
            .|:.|..|::...|..|        |...:|.|.|.                    .||......
  Fly   359 LLRNVQVRVVDPHGQSL--------GPNQTGQILVR--------------------LNLRWGGYY 395

  Fly   484 NNNQEMEHKGTTNNEEQENNQDGFFKTGDICAYRNGNFYFLSKSSDIFTVGGYKVYGSEIKKVLI 548
            :|.||.:...|.:.:.......|:|..       .|..:|.|:.:|:|....:.:|..:|:.|::
  Fly   396 HNPQETQVTVTPDGKWLLTGDHGYFDD-------EGCLHFQSRDTDVFKYNHFPIYPKQIEDVIL 453

  Fly   549 SHPNINDVAVLGIPNKM 565
            ..|.:::|||.|||:::
  Fly   454 HLPGVHEVAVFGIPDEV 470

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18155NP_996360.2 CaiC 53..604 CDD:223395 104/538 (19%)
AFD_class_I 58..607 CDD:302604 102/535 (19%)
CG9993NP_611518.1 CaiC 21..532 CDD:223395 104/538 (19%)
AFD_class_I 45..528 CDD:302604 101/531 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0318
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24096
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.