DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18155 and dip-2

Sequence 1:NP_996360.2 Gene:CG18155 FlyBaseID:FBgn0029945 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_001293298.1 Gene:dip-2 WormBaseID:WBGene00017885 Length:1681 Species:Caenorhabditis elegans

Alignment Length:678 Identity:126/679 (19%)
Similarity:230/679 (34%) Gaps:203/679 (30%)


  Fly    35 HSFDEEERSNVVVPTFKKAMLYPDEIAVKDINGEYTYFQLYMAAKRLG-------IQISN----- 87
            |.|......|:       |.:..|:.|..  :.:.||.:|:..|.::.       :|::.     
 Worm   416 HRFGTTAAKNI-------AAMVLDQSAKP--STQLTYGKLHSRAGKVAYMLLTKTVQVNKDGSKN 471

  Fly    88 -ICGGAALSNVTYLCSNNALWIAIQWSCWISGQVAVPLESGQA-----IDQLQRQASNCKTKLLI 146
             :|.......:.|..:....::|..:.|..:|.:.||:|...:     |.||.....||..|:.:
 Worm   472 VMCKPGDRVALIYPNTQPLHFLAAFYGCLQAGVIPVPVEMPSSKREAGIAQLGFLLGNCGVKVAL 536

  Fly   147 ATKEFESLAQELSQGVKSATIILDHSFLPTAESVSSTSMYAKQLVAIQG-----VIVTEN----- 201
            .:   ||..:.|.:.|.:::..   |....:.|::.||   .::|..:|     ..|||:     
 Worm   537 TS---ESCYKGLPKKVNTSSTF---SAPSGSNSLTGTS---SEIVDFRGWPRLWWAVTEHMSKPS 592

  Fly   202 ---TFPNDFYSKAPAMLIYTPNAVNSPKPVLLTHRNIEAQMRCLIGTWHLGPTDCMLPILSMNR- 262
               |.|.....:..|.:.||.....:.|...:|.:.:.|..|.|.........:.|:.::...| 
 Worm   593 RDWTAPPRLADETIAYIEYTTGNDGTVKGCCVTRQAVFAHCRALTTAMEYKEDETMVCVVDFKRE 657

  Fly   263 ---MHAALAAVLSVGGNVVLQQKFDGHNAWSALLGINSPSKQRVTLFLAMPIVYKRLIVEYEKMF 324
               .||.||::.: |..|:...        .:|:.:|             |..:..::.:|:...
 Worm   658 VGLWHAILASIFN-GMKVIFVP--------YSLMKMN-------------PATWMHMVSKYQATT 700

  Fly   325 A-KDSRMVEY--IVNHCRQKIRLMATAFALLPDSVFYRWREITGQNIYEYYGMMETGLVLGHPLN 386
            | ..||.:.:  :.....:.|.|.:....|:.|          |.|                |.:
 Worm   701 ALVKSRDLHWALLATRDHKDISLASLRTLLVAD----------GAN----------------PWS 739

  Fly   387 KRQRDSPHNGPTAVAMANNTAPNDYRP------------GTLGSPLKGVTARLISNKGDELIT-- 437
            ....|       |.|.|...:|...||            ||:....:| .|:|.|..|..:::  
 Worm   740 LSSCD-------AFAAAFTPSPYSLRPDAMCPCAGSSETGTISIRRRG-NAQLGSQSGRGILSMS 796

  Fly   438 ----C--KNELGGSVDSGLIPVEDIGGDASLAGTIIGELQIAGSNLVSN--------TLANNNQE 488
                |  :.:...|:.|  :.::|.|  ..:||.::....|.|||.:..        ..||:..:
 Worm   797 ALSHCVVRVDTENSLTS--LTLQDAG--QIVAGAVVVVTAIDGSNRLCQADEIGEICVSANSTAQ 857

  Fly   489 M--EHKGTTNNEEQENNQDGFFKTGDICAY----------RNGNFYFLSKSSDIFTVGGYKVYGS 541
            :  ...|.|::.         ||...:..|          |:|...|:.....:|.|...:    
 Worm   858 LYWALDGQTHHT---------FKVEPVGEYGKLIGAVRYVRSGLIGFMGPDGMVFVVARRQ---- 909

  Fly   542 EIKKVLISHPNINDV--AVLGIPNKMWGHRLGVICIVSPDADID--------------------- 583
            .:..|...:.:.:|:  .||.:....:.:| |.||:.|.....|                     
 Worm   910 SLLAVSGRYHSADDIIATVLAVEPMKFVYR-GRICVFSTSVLRDERIVIVAEQKPNCSEEEAFDW 973

  Fly   584 ----LDAIKT------YCYRHLPAHKCP 601
                |.||.|      ||...:||:..|
 Worm   974 ITRVLRAIDTIHQVGIYCCALVPANHLP 1001

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18155NP_996360.2 CaiC 53..604 CDD:223395 123/661 (19%)
AFD_class_I 58..607 CDD:302604 122/656 (19%)
dip-2NP_001293298.1 DMAP_binding 4..114 CDD:283995
AFD_class_I 432..1020 CDD:302604 122/656 (19%)
CaiC 438..1023 CDD:223395 120/648 (19%)
CaiC 1069..1672 CDD:223395
AFD_class_I 1109..1669 CDD:302604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.