DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18155 and hll

Sequence 1:NP_996360.2 Gene:CG18155 FlyBaseID:FBgn0029945 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_609696.1 Gene:hll FlyBaseID:FBgn0286723 Length:681 Species:Drosophila melanogaster

Alignment Length:592 Identity:112/593 (19%)
Similarity:191/593 (32%) Gaps:214/593 (36%)


  Fly    95 SNVTYLCSNNALWIAIQWSCWISGQVAV---PLESGQAIDQLQRQASNCKTKLLIATKEFESLAQ 156
            |:|..|..|...|...::....:|.|..   |..|.:|:..:                       
  Fly    95 SSVGILAFNCPEWFFAEFGALRAGAVVAGVYPSNSAEAVHHV----------------------- 136

  Fly   157 ELSQGVKSATIILDHSFLPTAESVSSTSMYAKQLVAIQGVI---------------VTENTFPND 206
             |:.|..|..::.|...:....::.......|.::.:.|..               :.|.||.::
  Fly   137 -LATGESSVCVVDDAQQMAKLRAIKERLPRLKAVIQLHGPFEAFVDHEPGYFSWQKLQEQTFSSE 200

  Fly   207 -----------FYSKAPAMLIYTPNAVNSPKPVLLTHRNI-------EAQMRCL-IGTWHLGPTD 252
                       ..:...||||:|...|..||.|:|:|.|:       .|.|:.: :|      .:
  Fly   201 LKEELLARESRIRANECAMLIFTSGTVGMPKAVMLSHDNLVFDTKSAAAHMQDIQVG------KE 259

  Fly   253 CMLPILSMNRMHAALAAV---LSVGGNVVLQQKFDGHNAWSALLG--INSPSKQRVTLFLAMPIV 312
            ..:..|.::.:.|.:..|   ||..|.|....|       .||.|  |.:..|.|.|....:|.|
  Fly   260 SFVSYLPLSHVAAQIFDVFLGLSHAGCVTFADK-------DALKGTLIKTFRKARPTKMFGVPRV 317

  Fly   313 YKRLIVEYEKMFAKDSRMVEY-----------IVNHCRQKIRLMATAFALLPDSVFYRW------ 360
            :::|   .|::.|.:::...|           :..|   :..|||.....:..:..| |      
  Fly   318 FEKL---QERLVAAEAKARPYSRLLLARARAAVAEH---QTTLMAGKSPSIYGNAKY-WLACRVV 375

  Fly   361 ---REITGQN--------------------------IYEYYGMMETGLVLGHPLNKRQRDSPHNG 396
               ||:.|.:                          :.|.|||.||                   
  Fly   376 KPIREMIGVDNCRVFFTGGAPTSEELKQFFLGLDIALGECYGMSET------------------- 421

  Fly   397 PTAVAMANNTAPNDYRPGTLGSPLKGVTARLISNKGDELITCKNELGGSVDSGLIPVEDIGGDAS 461
             :.....|....|.|   :.|...:|||.:                        |...|..|.  
  Fly   422 -SGAITLNVDISNLY---SAGQACEGVTLK------------------------IHEPDCNGQ-- 456

  Fly   462 LAGTIIGELQIAGSNLVSNTLANNNQEMEHKGTTNNEEQENNQDGFFKTGDICAY--RNGNFYFL 524
                  ||:.:.| .||.         |.:.|..:..|:...:||:..:||: .|  ..||....
  Fly   457 ------GEILMRG-RLVF---------MGYLGLPDKTEETVKEDGWLHSGDL-GYIDPKGNLIIS 504

  Fly   525 SKSSD-IFTVGGYKVYGSEIKKVLISH-PNINDVAVLGIPNKMWGHR--LGVICIVSPDAD---- 581
            .:..: |.|.||..:....|::::... |.:::|.::|      .||  |.|:..:....|    
  Fly   505 GRLKELIITAGGENIPPVHIEELIKKELPCVSNVLLIG------DHRKYLTVLLSLKTKCDAKTG 563

  Fly   582 IDLDAIK 588
            |.|||::
  Fly   564 IPLDALR 570

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18155NP_996360.2 CaiC 53..604 CDD:223395 112/593 (19%)
AFD_class_I 58..607 CDD:302604 112/593 (19%)
hllNP_609696.1 FAA1 37..681 CDD:223953 112/593 (19%)
AFD_class_I 62..680 CDD:302604 112/593 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24096
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.