DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18155 and Aasdh

Sequence 1:NP_996360.2 Gene:CG18155 FlyBaseID:FBgn0029945 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_609230.2 Gene:Aasdh FlyBaseID:FBgn0027780 Length:1012 Species:Drosophila melanogaster

Alignment Length:421 Identity:78/422 (18%)
Similarity:141/422 (33%) Gaps:134/422 (32%)


  Fly   173 FLPTAESVSSTSMYAKQLVAIQGVIVTENTFPNDFYSKAP-------AMLIY------------- 217
            |.||.:.:.|..:|::...|....:|.     |...:.||       ::|::             
  Fly    97 FFPTDKMMLSQDLYSQMSTAGVDYLVA-----NKHLTVAPLYFTFLGSILVFKEDCRLYRVKLKS 156

  Fly   218 TPNAVNSPKPVLLTHRNIEAQMRCLIGTW---------HLGPTDCMLP-ILSMN-RMHAALAAVL 271
            ....|.|.||       :.|.|...|.|.         |: |.:|:.| |:.:: :::.::|.::
  Fly   157 ADETVQSKKP-------LPANMCYTISTTGTTGKPKLIHV-PYECIAPNIVGLSQKLNVSMADII 213

  Fly   272 SVGGNVVLQQKFDG---------HNAWSALLG----INSPSKQRVTLF---LAMP-IVYKRLIVE 319
            .:|..:.    ||.         .|..:.|..    .:||||....||   ||.| |...::...
  Fly   214 YLGTPIT----FDPFVVEFFLALQNGATLLTSRHSMRDSPSKVLSALFPDNLATPGITVLQMTPS 274

  Fly   320 YEKMFAKDSRMVEYIVNHCRQKIRLMATAFALLPDSV-FYRWRE---ITGQNIYEYYGMMETGL- 379
            ..:.|...|  ::..|......:|::.......|.:| ...|..   :..::|...||:.|... 
  Fly   275 LFRQFGASS--IKDRVLSGSSSLRVLLLGGEPFPSNVELVTWMHPSVLMQKHICNIYGITEISCW 337

  Fly   380 VLGHPLNKRQRDSPHNGPTAVAMANNTAPNDYRPGTLGSPLKGVTARLISNKGDELITCKNELGG 444
            .|.|.:...|...|                      ||:|::..|...|.::.:|.........|
  Fly   338 SLLHIVQSLQSPVP----------------------LGTPIEEDTVLRIESEDNETSQQGELFLG 380

  Fly   445 SVDSG-LIPVEDIGGDASLAGTIIGELQIAGSNLVSNTLANNNQEMEHKGTTNNEEQENNQDGFF 508
            ||... .||..|...:||                                      |:::...|.
  Fly   381 SVKRRCYIPEVDDQANAS--------------------------------------QDDSGICFR 407

  Fly   509 KTGD-ICAYRNGNFYFLSKSSDIFTVGGYKV 538
            .||| :...::|..::..:|:|:....|.::
  Fly   408 ATGDLVTRQQDGTLFYSERSNDVVKRAGNRI 438

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18155NP_996360.2 CaiC 53..604 CDD:223395 78/422 (18%)
AFD_class_I 58..607 CDD:302604 78/422 (18%)
AasdhNP_609230.2 AA-adenyl-dom 46..443 CDD:273779 78/422 (18%)
AFD_class_I <168..522 CDD:302604 63/339 (19%)
PQQ_DH_like <728..1012 CDD:299747
PQQ_2 732..978 CDD:290097
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C96795424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.