DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18155 and pdgy

Sequence 1:NP_996360.2 Gene:CG18155 FlyBaseID:FBgn0029945 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_001188590.1 Gene:pdgy FlyBaseID:FBgn0027601 Length:597 Species:Drosophila melanogaster

Alignment Length:580 Identity:120/581 (21%)
Similarity:213/581 (37%) Gaps:163/581 (28%)


  Fly    68 EYTYFQLYMAAKRLGIQIS---NICGGAALSNVTYLCSNN------ALWIAIQWSCWISGQVAVP 123
            :||:.|:..|:....:::.   |:    ...:|..:|..|      |...||:     :|.....
  Fly   102 QYTFAQMRDASAAFAVRLQTKFNL----QKPDVLAICLPNLPEYPIATLGAIE-----AGLTVTT 157

  Fly   124 LESGQAIDQLQRQASNCKTKLLIAT-KEFESLAQELSQGVKSATIILDHSFLPTA-------ESV 180
            :......|::.||.:....|.|:.| ..|.:|:|        |:.::... :|.|       |::
  Fly   158 VNPVYTPDEIARQLTFSGAKFLVGTVSGFATLSQ--------ASKLVGRQ-IPIAVVRTSAEEAL 213

  Fly   181 SSTSMYAKQLVAIQGVIVTENTFPNDFYSKAPAMLIYTPNAVNSPKPVLLTHRNIEA---QMRCL 242
            ...::...:|.:.|.|...:...|.:..:.....|.::......||.|:|:|.||.:   |::..
  Fly   214 PEGAIDFSELTSTQNVRYEDLKAPKEASADDMVFLPFSSGTTGLPKGVMLSHNNITSNCEQVQAS 278

  Fly   243 IGTWHLGPTDCMLPILSMNRMHAALAAVLSVGGNVVLQQKFDGHNAWSALLGINSPSKQRVTLFL 307
            :      |.|.|.|   .|.:...|......|..||:..|          ||             
  Fly   279 L------PLDLMGP---QNTLPGVLPFFHIYGLTVVMLSK----------LG------------- 311

  Fly   308 AMPIVYKRLIVEYEKMFAKDSRMVEYIVNHCRQKIRLMATAFALLPDSVFYRWREITGQNIYEYY 372
                                        ..||     :||.....||. |.|       ::.:|.
  Fly   312 ----------------------------QGCR-----LATMPCFKPDD-FMR-------SLDKYQ 335

  Fly   373 GMMETGLV-------LGHPLNKRQRDSPH-----NGPTAVAMAN-----NTAPND-YRPG---TL 416
            |.: ..||       :.|| ...|..:||     :|...:...:     |..||. ::.|   |.
  Fly   336 GSI-LNLVPPIALFMINHP-KLTQETAPHLKVVMSGAAPIGQHDVERFLNKFPNTVFKQGYGMTE 398

  Fly   417 GSPLKGVTARLISNKGDELITCKNELGGSVDSGLIPVEDIGGDASLAG-TIIGELQIAGSNLVSN 480
            .||:.     |::.:|:::......|..|.::.::|::  |.||...| ...|||.:.|..::: 
  Fly   399 ASPVV-----LLTPEGNKVYASTGVLPASTEAKIVPLD--GSDAKGVGPRTTGELCVRGPQVMA- 455

  Fly   481 TLANNNQEMEHKGTTNNEEQENNQDGFF-----KTGDICAY-RNGNFYFLSKSSDIFTVGGYKVY 539
                        |..||:|.  ||..|:     ::||:..| .:|.||...:..::..|.|::|.
  Fly   456 ------------GYLNNDEA--NQVTFYPGNWLRSGDVAFYDEDGLFYITDRMKELIKVKGFQVP 506

  Fly   540 GSEIKKVLISHPNINDVAVLGIPNKMWGHRLGVICIVSPDADIDLDAIKTYCYRHLPAHK 599
            .:|::.||..||.|.:.||.|||::..|.....|.::........:.|..|....:..:|
  Fly   507 PAELEAVLRDHPKILEAAVFGIPHEFNGEAPRAIVVLRQGEKASAEEISAYVAERVAHYK 566

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18155NP_996360.2 CaiC 53..604 CDD:223395 120/581 (21%)
AFD_class_I 58..607 CDD:302604 120/581 (21%)
pdgyNP_001188590.1 CaiC 77..595 CDD:223395 120/581 (21%)
Firefly_Luc_like 99..587 CDD:213279 120/581 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0318
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24096
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R434
33.030

Return to query results.
Submit another query.