DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18155 and Acsf3

Sequence 1:NP_996360.2 Gene:CG18155 FlyBaseID:FBgn0029945 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_659181.2 Gene:Acsf3 MGIID:2182591 Length:583 Species:Mus musculus

Alignment Length:610 Identity:171/611 (28%)
Similarity:275/611 (45%) Gaps:104/611 (17%)


  Fly    18 LCSAELI---HKDGFIEKLRHSF---DEEERSNVVVPTFKKAMLYPDEIAVKDINGEYTYFQLYM 76
            |.|::||   |:.       ||.   ..|..::..||.|.:|:.:.|.||:.|..|.:||.:||.
Mouse    16 LASSQLIPRRHRG-------HSLLPTTPEAHTDGSVPVFIRALAFGDRIALIDKYGHHTYRELYD 73

  Fly    77 AAKRLGIQISNI--C--GGAALSNVTYLCSNNALWIAIQWSCWISGQVAVPLESGQAIDQLQRQA 137
            .:..|..:|..:  |  |......|::||||:..::..||:.|:||.|||||.......||:...
Mouse    74 RSLCLAQEICRLQGCKVGDLQEERVSFLCSNDVSYVVAQWASWMSGGVAVPLYWKHPEAQLEYFI 138

  Fly   138 SNCKTKLLIATKEF----ESLAQELSQGVKSATIILDHSFLPTAESV--SSTSMYAKQLVAIQGV 196
            .:.::.|::..:|:    ..|||.|  ||         ..||...:|  .:|....:|.|...| 
Mouse   139 QDSRSSLVVVGQEYLERLSPLAQRL--GV---------PLLPLTPAVYHGATEKPTEQPVEESG- 191

  Fly   197 IVTENTFPNDFYSKAPAMLIYTPNAVNSPKPVLLTHRNIEAQMRCLIGTWHLGPTDCMLPILSMN 261
                       :....||:.||......||..|.||||:.|.:..|:.:|.....|.:|.:|.::
Mouse   192 -----------WRDRGAMIFYTSGTTGRPKGALSTHRNLAAVVTGLVHSWAWTKNDVILHVLPLH 245

  Fly   262 RMHAA---LAAVLSVGGNVVLQQKFDGHNAWSALLGINSPSKQRVTLFLAMPIVYKRLIVEYEKM 323
            .:|..   |...|.||...|:..:|.....|...|...:|   ::|:|:|:|.||.:|:..|:|.
Mouse   246 HVHGVVNKLLCPLWVGATCVMLPEFSAQQVWEKFLSSEAP---QITVFMAVPTVYSKLLDYYDKH 307

  Fly   324 FAKDSRMVEYIVNHCRQKIRLMATAFALLPDSVFYRWREITGQNIYEYYGMMETGLVLGHPLNKR 388
            |.: ..:.:::...|:::||||.:..|.||..:..:||..||..:.|.|||.|.|:.|.:||.:.
Mouse   308 FTQ-PHVQDFVRAVCKERIRLMVSGSAALPVPLLEKWRSATGHTLLERYGMTEIGMALSNPLTEA 371

  Fly   389 QRDSPHNGPTAVAMANNTAPNDYRPGTLGSPLKGVTARLIS---NKGDELITCK--NELGGSVDS 448
            :                      .||::|:||.||..|:||   .||...|...  ||.|..|..
Mouse   372 R----------------------VPGSVGTPLPGVEVRIISENPQKGSPYIIHAEGNERGTKVTP 414

  Fly   449 GLIPVEDIGGDASLAGTIIGELQIAGSNLVSNTLANNNQEMEHKGTTNNEEQENNQDGFFKTGDI 513
            |....|             |||.:.|.::.          .|:.......:.....||:|:|||.
Mouse   415 GFEEKE-------------GELLVRGPSVF----------REYWDKPEETKSAFTSDGWFRTGDT 456

  Fly   514 CAYRNGNFYFLSKSS-DIFTVGGYKVYGSEIKKVLISHPNINDVAVLGIPNKMWGHRLGVICIVS 577
            ..:::..::...::| ||...|||||...||::.|::||:|.||||:|:|:..||.|:..:..:.
Mouse   457 AVFKDARYWIRGRTSVDIIKTGGYKVSALEIERHLLAHPSITDVAVIGVPDMTWGQRVTAVVALQ 521

  Fly   578 PDADIDLDAIKTYCYRHLPAHKCPT 602
            ....:....:|.:....|..:..|:
Mouse   522 EGHSLSHGDLKEWARGVLAPYAVPS 546

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18155NP_996360.2 CaiC 53..604 CDD:223395 160/570 (28%)
AFD_class_I 58..607 CDD:302604 159/565 (28%)
Acsf3NP_659181.2 CaiC 49..572 CDD:223395 160/571 (28%)
MCS 55..564 CDD:213307 159/565 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C321086110
eggNOG 1 0.900 E1_COG0318
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 220 1.000 Inparanoid score I3531
Isobase 1 0.950 0.946395 Normalized mean entropy S3694
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003173
OrthoInspector 1 1.000 T1083224
orthoMCL 1 0.900 OOG5_129266
Panther 1 1.100 LDO PTHR24096
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R434
TreeFam 1 0.960
1312.740

Return to query results.
Submit another query.