DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18155 and Dip2b

Sequence 1:NP_996360.2 Gene:CG18155 FlyBaseID:FBgn0029945 Length:610 Species:Drosophila melanogaster
Sequence 2:XP_011243931.1 Gene:Dip2b MGIID:2145977 Length:1619 Species:Mus musculus

Alignment Length:613 Identity:115/614 (19%)
Similarity:206/614 (34%) Gaps:208/614 (34%)


  Fly    64 DINGE----YTYFQLYMAAKRLGIQISNICG---------GAALSNVTYLCSNN--ALWIAIQWS 113
            |:.|:    .||.:|:..:.:|...:.|..|         |   ..|..:..||  .:::...:.
Mouse   358 DVTGKPVYTLTYGKLWSRSLKLAYTLLNKLGTKNEPVLKPG---DRVALVYPNNDPVMFMVAFYG 419

  Fly   114 CWISGQVAVPLE--------SGQAIDQLQRQASNCKTKLLIATKEFESLAQELSQGVKSATIILD 170
            |.::..:.||:|        .||.|..|   ..:|...|        :|..|:.  :|.      
Mouse   420 CLLAEVIPVPIEVPLTRKDAGGQQIGFL---LGSCGIAL--------ALTSEIC--LKG------ 465

  Fly   171 HSFLPTAESVSSTSMYAKQLVAIQG-----VIVTENTF----PNDFY------SKAPAMLIYTPN 220
               ||..::        .::|..:|     .:||::.:    |.|:.      ...||.:.|..:
Mouse   466 ---LPKTQN--------GEIVQFKGWPRLKWVVTDSKYLSKPPKDWQPHISPAGTEPAYIEYKTS 519

  Fly   221 AVNSPKPVLLTHRNIEAQMRCLIGTWHLGPTDCMLPILS---------------MNRMHAALAAV 270
            ...|...|.::...:.:|.:.|....:....:.::.:|.               ||:|| .::..
Mouse   520 KEGSVMGVTVSRLAMLSQCQALSQACNYSEGETVVNVLDFKKDAGLWHGMFANVMNKMH-TISVP 583

  Fly   271 LSVGGNVVLQ--QKFDGHNAWSALLGINSPSKQRVTLFLAMPIVYKRLIVEYEKMFAKDSRMVEY 333
            .||.....|.  |:...|.|..||:                    |...:.:..|..:|.|.|..
Mouse   584 YSVMKTCPLSWVQRVHAHKAKVALV--------------------KCRDLHWAMMAHRDQRDVSL 628

  Fly   334 IVNHCRQKIRLMATAFALLPDSV-----FYRWREITGQNIYEYYGMMETGLVLGHPLNKRQRDSP 393
                  ..:|::.......|.||     |.        ::::.:|:....:.             
Mouse   629 ------SSLRMLIVTDGANPWSVSSCDAFL--------SLFQSHGLKPEAIC------------- 666

  Fly   394 HNGPTAV-AMANNTAPNDYRPGTLGSPLKGVTARLISNKG-------------DELITCKNELGG 444
               |.|. |.|...|..  |||..|:||.|  ..::|..|             :..:|.: ::|.
Mouse   667 ---PCATSAEAMTVAIR--RPGVPGAPLPG--RAILSMNGLSYGVIRVNTEDKNSALTVQ-DVGH 723

  Fly   445 SVDSGLIPVEDIGGDASLAGT-IIGELQIAG--SNLVSNTLANNNQEMEHKGTTNN--EEQENNQ 504
            .:..|::.:....|...|..| .|||:.::.  ..::...||         |.|.|  |......
Mouse   724 VMPGGMMCIVKPDGLPQLCRTDEIGEICVSSRTGGMMYFGLA---------GVTKNTFEVIPVTS 779

  Fly   505 DGFFKTGDICAYRNGNFYFLSKSSDIFTVGGYKVYGSEIKKVLIS--HPNINDVAVLGIPNKMWG 567
            .| ...||:...|:|...|:...|.:|.||  |:.|    .:::|  ..|.:|:...|:.     
Mouse   780 SG-SPVGDVPFIRSGLLGFVGPGSLVFVVG--KMDG----LLMVSGRRHNADDIVATGLA----- 832

  Fly   568 HRLGVICIVSPDADIDLDAIKT-YCYRH 594
                            :::||| |..||
Mouse   833 ----------------VESIKTVYRGRH 844

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18155NP_996360.2 CaiC 53..604 CDD:223395 115/614 (19%)
AFD_class_I 58..607 CDD:302604 115/614 (19%)
Dip2bXP_011243931.1 DMAP_binding 14..130 CDD:283995
PRK07769 357..969 CDD:181109 115/614 (19%)
AFD_class_I 358..967 CDD:302604 115/614 (19%)
AMP-binding 1038..1513 CDD:278902
AFD_class_I 1055..1608 CDD:302604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.