DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18155 and DIP2A

Sequence 1:NP_996360.2 Gene:CG18155 FlyBaseID:FBgn0029945 Length:610 Species:Drosophila melanogaster
Sequence 2:XP_011527794.1 Gene:DIP2A HGNCID:17217 Length:1607 Species:Homo sapiens

Alignment Length:611 Identity:112/612 (18%)
Similarity:195/612 (32%) Gaps:226/612 (37%)


  Fly   102 SNNALWIAIQWSCWISGQVAVPLESGQAIDQLQRQASNCKTKLLIAT-KEFESLAQELSQ-GVKS 164
            |:..:::...:.|.::..|.||:|    :...::.|.:.:...|:.: ..|.:|..:..| |:..
Human   442 SDPVMFMVAFYGCLLAELVPVPIE----VPLTRKDAGSQQVGFLLGSCGVFLALTTDACQKGLPK 502

  Fly   165 ATIILDHSFLPTAESVSSTSMYAKQLVAIQGVIVTENTFPNDFYSKA------PAMLIYTPNAVN 223
            |         .|.|..:.........:.|.|..:.:.  |.|::..|      .|.:.|..:...
Human   503 A---------QTGEVAAFKGWPPLSWLVIDGKHLAKP--PKDWHPLAQDTGTGTAYIEYKTSKEG 556

  Fly   224 SPKPVLLTHRNIEAQMRCL---------------------IGTWHLGPTDCMLPILS--MNRMHA 265
            |...|.::|.::.||.|.|                     .|.||        .:|:  ||||| 
Human   557 STVGVTVSHASLLAQCRALTQACGYSEAETLTNVLDFKRDAGLWH--------GVLTSVMNRMH- 612

  Fly   266 ALAAVLSVGGNVVLQQKFDGHNAWSALLGINSPS-KQRVTLFLAMPIVYKRLIVEYEKMFAKDSR 329
                |:||.               .||:..|..| .|:|..:.|...:.|...:.:..:..:..|
Human   613 ----VVSVP---------------YALMKANPLSWIQKVCFYKARAALVKSRDMHWSLLAQRGQR 658

  Fly   330 MVEYIVNHCRQKIRLMATAFALLPDSV-----FYRWREITGQNIYEYYGMMETGLVLGHPLNKRQ 389
            .|..      ..:|::..|....|.|:     |.        |:::..|:               
Human   659 DVSL------SSLRMLIVADGANPWSISSCDAFL--------NVFQSRGL--------------- 694

  Fly   390 RDSPH------NGPTAVAMANNTAPNDYRPGTLGSP--------LKGVTARLISNKGDELITCKN 440
              .|.      :.|.|:.:|..      ||..||.|        :.|::..:|....:|.::   
Human   695 --RPEVICPCASSPEALTVAIR------RPPDLGGPPPRKAVLSMNGLSYGVIRVDTEEKLS--- 748

  Fly   441 ELGGSVDSGLIPVEDIG--------------GDASLAGT-IIGELQIAGSNLVSNTLANNNQEME 490
                     ::.|:|:|              |...|..| .:||:.::.|       |.......
Human   749 ---------VLTVQDVGQVMPGANVCVVKLEGTPYLCKTDEVGEICVSSS-------ATGTAYYG 797

  Fly   491 HKGTTNNEEQENNQDGFFK-----TGDICAY-----RNGNFYFLSKSSDIFTVG---GYKVYGSE 542
            ..|.|.|         .|:     ||....:     |.|...|:...:.:|.||   |..|.|  
Human   798 LLGITKN---------VFEAVPVTTGGAPIFDRPFTRTGLLGFIGPDNLVFIVGKLDGLMVTG-- 851

  Fly   543 IKKVLISHPNINDVAVLGI---PNK-MWGHRLGVICIV-------------SPDAD--------- 581
                 :...|.:||....:   |.| ::..|:.|..:.             .|||.         
Human   852 -----VRRHNADDVVATALAVEPMKFVYRGRIAVFSVTVLHDDRIVLVAEQRPDASEEDSFQWMS 911

  Fly   582 -----ID-LDAIKTYCYRHLPAHKCP 601
                 || :..:..||...:||:..|
Human   912 RVLQAIDSIHQVGVYCLALVPANTLP 937

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18155NP_996360.2 CaiC 53..604 CDD:223395 112/612 (18%)
AFD_class_I 58..607 CDD:302604 112/612 (18%)
DIP2AXP_011527794.1 DMAP_binding 9..158 CDD:283995
CaiC 360..959 CDD:223395 112/612 (18%)
AFD_class_I 392..956 CDD:302604 112/612 (18%)
AMP-binding 1027..1501 CDD:278902
AFD_class_I 1044..1596 CDD:302604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.