DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18155 and Dip2c

Sequence 1:NP_996360.2 Gene:CG18155 FlyBaseID:FBgn0029945 Length:610 Species:Drosophila melanogaster
Sequence 2:XP_006516536.1 Gene:Dip2c MGIID:1920179 Length:1616 Species:Mus musculus

Alignment Length:661 Identity:122/662 (18%)
Similarity:218/662 (33%) Gaps:230/662 (35%)


  Fly    60 IAVKDINGE----YTYFQLYMAAKRLGIQISNICG---------GAALSNVTYLCSNN--ALWIA 109
            :...|.||:    .||.:|:..:.::...|.:..|         |   ..|..:..||  |.::.
Mouse   393 LTTMDTNGKPLYILTYGKLWTRSMKVAYNILHKLGTKQEPMVRPG---DRVALVFPNNDPAAFMV 454

  Fly   110 IQWSCWISGQVAVPLESGQAIDQLQRQASNCKTKLLIATKEFESLAQELSQGVKSATIILD---- 170
            ..:.|.::..|.||:|    :...::.|.:.:...|:.           |.||   |:.|.    
Mouse   455 AFYGCLLAEVVPVPIE----VPLTRKDAGSQQIGFLLG-----------SCGV---TVALTSDAC 501

  Fly   171 HSFLPTAES--VSSTSMYAKQLVAIQGVIVTENTF----PNDFY------SKAPAMLIY------ 217
            |..||.:.:  :.....:.|.|     ..|||:..    |.|::      :...|.:.|      
Mouse   502 HKGLPKSPTGEIPQFKGWPKLL-----WFVTESKHLSKPPRDWFPHIKDANNDTAYIEYKTCKDG 561

  Fly   218 TPNAVNSPKPVLLTH----------RNIEAQMRCL-----IGTWHLGPTDCMLPILS--MNRMHA 265
            :...|...:..||||          ...|..:..|     :|.||        .||:  ||.|| 
Mouse   562 SVLGVTVTRIALLTHCQALTQACGYTEAETIVNVLDFKKDVGLWH--------GILTSVMNMMH- 617

  Fly   266 ALAAVLSVGGNVVLQQKFDGHNAWSALLGINSPSKQRVTLFLAMPIVYKRLIVEYE-KMFAKDSR 329
                |:|:.               .:|:.:|             |:.:.:.:.:|: |:....||
Mouse   618 ----VISIP---------------YSLMKVN-------------PLSWIQKVCQYKAKVACVKSR 650

  Fly   330 MVEY-IVNHCRQK------IRLMATAFALLPDSV-----FYRWREITGQNIYEYYGMMETGLVLG 382
            .:.: :|.|..|:      :|::..|....|.|:     |.        |:::..|:        
Mouse   651 DMHWALVAHRDQRDVNLSSLRMLIVADGANPWSISSCDAFL--------NVFQSKGL-------- 699

  Fly   383 HPLNKRQR------DSPHNGPTAVAMANNTAPNDYRPGTLGSPLKGVTARLISNKGDELITCKNE 441
                 ||.      .||.  ...||:...|..::..||.....:.|:|..:|....:|.::    
Mouse   700 -----RQEVICPCASSPE--ALTVAIRRPTDDSNQPPGRGVLSMHGLTYGVIRVDSEEKLS---- 753

  Fly   442 LGGSVDSGLIPVEDIG--------------GDASLAGT-IIGELQIAG----------SNLVSNT 481
                    ::.|:|:|              |...|..| .||||.:..          |.:..||
Mouse   754 --------VLTVQDVGLVMPGAIMCSVKPDGIPQLCRTDEIGELCVCAVATGTSYYGLSGMTKNT 810

  Fly   482 LANNNQEMEHKGTTNNEEQENNQDGFFKTGDICAYRNGNFYF-LSKSSDIFTVGGYKVYGSEIKK 545
            .  ....|...|...:|..      |.:||.:.....|...| :.|...:..|.|.:....:|..
Mouse   811 F--EVFPMTSSGAPISEYP------FIRTGLLGFVGPGGLVFVVGKMDGLMVVSGRRHNADDIVA 867

  Fly   546 VLISHPNI-----NDVAVLGIPNKMWGHRLGVICIVSPDAD--------------ID-LDAIKTY 590
            ..::...:     ..:||..: ..:...|:.::....||:.              || :..:..|
Mouse   868 TALAVEPMKFVYRGRIAVFSV-TVLHDERIVIVAEQRPDSTEEDSFQWMSRVLQAIDSIHQVGVY 931

  Fly   591 CYRHLPAHKCP 601
            |...:||:..|
Mouse   932 CLALVPANTLP 942

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18155NP_996360.2 CaiC 53..604 CDD:223395 122/662 (18%)
AFD_class_I 58..607 CDD:302604 122/662 (18%)
Dip2cXP_006516536.1 DMAP_binding 7..176 CDD:283995
CaiC 373..964 CDD:223395 122/662 (18%)
Dip2 397..961 CDD:213273 122/658 (19%)
AMP-binding 1036..1510 CDD:278902
AFD_class_I 1053..1605 CDD:302604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.