DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18155 and ACSF3

Sequence 1:NP_996360.2 Gene:CG18155 FlyBaseID:FBgn0029945 Length:610 Species:Drosophila melanogaster
Sequence 2:XP_005256350.1 Gene:ACSF3 HGNCID:27288 Length:610 Species:Homo sapiens

Alignment Length:547 Identity:165/548 (30%)
Similarity:267/548 (49%) Gaps:81/548 (15%)


  Fly    42 RSNVVVPTFKKAMLYPDEIAVKDINGEYTYFQLYMAAKRLGIQISNICG--GAAL--SNVTYLCS 102
            ||:...|.|.:|:.:.|.||:.|.:|.:||.:||..:.||..:|..:||  |..|  ..|::||:
Human    39 RSDRSAPVFTRALAFGDRIALVDQHGRHTYRELYSRSLRLSQEICRLCGCVGGDLREERVSFLCA 103

  Fly   103 NNALWIAIQWSCWISGQVAVPLESGQAIDQLQRQASNCKTKLLIATKEFESLAQELSQGVKSATI 167
            |:|.::..||:.|:||.|||||.......||:....:.::.:::|::|:..|   ||..|:...:
Human   104 NDASYVVAQWASWMSGGVAVPLYRKHPAAQLEYVICDSQSSVVLASQEYLEL---LSPVVRKLGV 165

  Fly   168 ILDHSFLPTAESVSSTSMYAKQLVAIQGVIVTENTFPNDFYSKAPAMLIYTPNAVNSPKPVLLTH 232
            .|    ||...::.:.::.....|.:          |...:....||:|||......||.||.||
Human   166 PL----LPLTPAIYTGAVEEPAEVPV----------PEQGWRNKGAMIIYTSGTTGRPKGVLSTH 216

  Fly   233 RNIEAQMRCLIGTWHLGPTDCMLPILSMNRMHAALAAVLS---VGGNVVLQQKFDGHNAWSALLG 294
            :||.|.:..|:..|.....|.:|.:|.::.:|..:.|:|.   ||...|:..:|.....|...|.
Human   217 QNIRAVVTGLVHKWAWTKDDVILHVLPLHHVHGVVNALLCPLWVGATCVMMPEFSPQQVWEKFLS 281

  Fly   295 INSPSKQRVTLFLAMPIVYKRLIVEYEKMFAKDSRMVEYIVNHCRQKIRLMATAFALLPDSVFYR 359
            ..:|   |:.:|:|:|.:|.:|:..|::.|.:.... :::...|.:|||||.:..|.||..|..:
Human   282 SETP---RINVFMAVPTIYTKLMEYYDRHFTQPHAQ-DFLRAVCEEKIRLMVSGSAALPLPVLEK 342

  Fly   360 WREITGQNIYEYYGMMETGLVLGHPLNKRQRDSPHNGPTAVAMANNTAPNDYRPGTLGSPLKGVT 424
            |:.|||..:.|.|||.|.|:.|..||.           |||.:          ||::|:||.||.
Human   343 WKNITGHTLLERYGMTEIGMALSGPLT-----------TAVRL----------PGSVGTPLPGVQ 386

  Fly   425 ARLISNKGDELITCK-------NELGGSVDSGLIPVEDIGGDASLAGTIIGELQIAGSNLVSNTL 482
            .|::| :..:...|.       :|.|..|..|....|             |||.:.|.: |....
Human   387 VRIVS-ENPQREACSYTIHAEGDERGTKVTPGFEEKE-------------GELLVRGPS-VFREY 436

  Fly   483 ANNNQEMEHKGTTNNEEQENNQDGFFKTGDICAYRNGNFYFLSKSS-DIFTVGGYKVYGSEIKKV 546
            .|..:|.:...|.         ||:|||||...:::|.::...::| ||...|||||...|::..
Human   437 WNKPEETKSAFTL---------DGWFKTGDTVVFKDGQYWIRGRTSVDIIKTGGYKVSALEVEWH 492

  Fly   547 LISHPNINDVAVLGIPNKMWGHRLGVI 573
            |::||:|.||||:|:|:..||.|:..:
Human   493 LLAHPSITDVAVIGVPDMTWGQRVTAV 519

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18155NP_996360.2 CaiC 53..604 CDD:223395 161/537 (30%)
AFD_class_I 58..607 CDD:302604 160/532 (30%)
ACSF3XP_005256350.1 AMP-binding 46..480 CDD:278902 143/500 (29%)
MCS 55..546 CDD:213307 160/532 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C321094132
eggNOG 1 0.900 E1_COG0318
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 236 1.000 Inparanoid score I3341
Isobase 1 0.950 0.946395 Normalized mean entropy S3694
OMA 1 1.010
OrthoDB 1 1.010 D229996at33208
OrthoFinder 1 1.000 FOG0003173
OrthoInspector 1 1.000 T1073153
orthoMCL 1 0.900 OOG5_129266
Panther 1 1.100 LDO PTHR24096
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R434
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.750

Return to query results.
Submit another query.