DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18155 and C25G6.3

Sequence 1:NP_996360.2 Gene:CG18155 FlyBaseID:FBgn0029945 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_508231.2 Gene:C25G6.3 WormBaseID:WBGene00016108 Length:578 Species:Caenorhabditis elegans

Alignment Length:568 Identity:104/569 (18%)
Similarity:199/569 (35%) Gaps:174/569 (31%)


  Fly    57 PDEIAVKDINGE---YTYFQLYMAAKRLGIQISNICGGAALSNVTYLCSNNAL-WIAIQWSCWIS 117
            |.:||:.:...|   .||.:|...:||....:|:  .|....:...:|..|.: ::..|...::.
 Worm   100 PAKIALIEEISEVRCVTYEELVDGSKRTANYMSH--HGVKNGDRILMCMENTVEYVLYQLGGFLL 162

  Fly   118 GQVAVPLESGQAIDQLQRQASNCKTKLLIATKEFE------SLAQELSQGVKSATIILDHSFLPT 176
            |.:.|.:.......: :.....|.|.::    :||      .::|...|.::...::        
 Worm   163 GAIPVLINPSHIASE-KLSDIGCTTAIV----DFEHYGHMLRISQSTLQSIERVFVL-------- 214

  Fly   177 AESVSSTSMYAKQLVAIQ--GVIVTENTFPNDFY--------SKAPAMLIYTPNAVNSPKPVL-- 229
            ||.:::.|: |:.:..|.  |.:    .||.::.        :.:.|.:|  |.::.:.:.:.  
 Worm   215 AEDIAAISL-ARHVWVIDAFGFL----GFPPNYVCDQFIEESNDSVAFII--PGSLENDQYISHS 272

  Fly   230 ------LTHRNIEAQMRCLIGTWHLGPTDCMLPILSMNRM-------HAALA---AVLSVGGNVV 278
                  |.|...|.....|..|..||         |.|.:       |.||:   .:|:.|.:.:
 Worm   273 QESGFHLCHDYFEQLFGMLKKTEQLG---------SKNHLITDGLHCHDALSYLYTILTKGESCI 328

  Fly   279 LQQKFDGHNAWSALL-----GINSPSKQRVTLFLAMPIVYKRLIVEYE--KMFAKDSRMVEYIVN 336
            |.:  ...:.|.|.|     ||  ..:.:|||..:...:.| ..::||  |::...|  :|.:.|
 Worm   329 LAE--STMDVWRASLLDRIAGI--IEQYKVTLLFSNSQLLK-CFIKYEVHKIYNLSS--LEIVAN 386

  Fly   337 HCRQKIRLMATAFALLPDSVFYRWREITGQNIYEYYGMMETGLVLGHPLNKRQRDSPHNGPTAVA 401
            |  ..:..:|||         .:.::|....:.:.|...|.|                       
 Worm   387 H--GAVVSVATA---------KKVKKILDVTLIQAYSAAEFG----------------------- 417

  Fly   402 MANNTAPNDYRPGTLGSPLKGVTARLISNKGD-------ELITCKNELGGSVDSGLIPV-EDIGG 458
                                      :::.||       :|:.|    |.|:|...|.| ..:..
 Worm   418 --------------------------VASFGDFDETLDKQLVNC----GHSIDDVKIKVIAHMET 452

  Fly   459 DASLAGTIIGELQIAGSNLVSNTLANNNQEMEHK-GTTNNEEQENNQDGFFKTGDICAY----RN 518
            |..:|....|::.::|..|:...:.|.......| |.:           :|||||   |    .|
 Worm   453 DKEMAKGKWGQVILSGRQLLKEYIGNKELNTSRKFGKS-----------WFKTGD---YGMIDEN 503

  Fly   519 GNFYFLSKSSDIFTVGGYKVYGSEIKKVLISHPNINDVAVLGIPNKMW 566
            ...:.....||:.|.....|....::.::..|..::||.|:.....:|
 Worm   504 DRVHIEGAISDLITAQNKLVSSEMMESIICEHKMVHDVVVMQNDQHVW 551

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18155NP_996360.2 CaiC 53..604 CDD:223395 104/569 (18%)
AFD_class_I 58..607 CDD:302604 103/568 (18%)
C25G6.3NP_508231.2 AMP-binding 99..516 CDD:278902 97/532 (18%)
AFD_class_I 115..543 CDD:302604 98/544 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.