DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18155 and mec-18

Sequence 1:NP_996360.2 Gene:CG18155 FlyBaseID:FBgn0029945 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_508731.3 Gene:mec-18 WormBaseID:WBGene00003179 Length:638 Species:Caenorhabditis elegans

Alignment Length:608 Identity:113/609 (19%)
Similarity:205/609 (34%) Gaps:196/609 (32%)


  Fly    50 FKKAMLYPDEIAVKDING--EYTYFQL----YMAAKRL-GIQISNICGGAALSNVTYLCSNNALW 107
            |.|...:...:|:.|::.  ::.|.::    .|.|.|| .:|:::   |   |.|..:.......
 Worm    24 FSKISAHGSNLAIVDVDSGKQWRYSEIRNWCEMCATRLKELQVTS---G---SRVAVITGTTGQA 82

  Fly   108 IAIQWSCWISGQVAVPLESGQAIDQL--------------------------------------- 133
            |.:..:|.|.|..||.:....|:|::                                       
 Worm    83 IFVHLACSIIGCSAVAVNGWNAVDEIWTLVDLSEATHLIVENQFMQKADDVRRKAQMRGGGRIKH 147

  Fly   134 QRQASNCKT----------KLLIATKEFESLAQELSQGVKSATIILDHSFLPTAESVSSTSMYAK 188
            .||..:..|          |..|..|:...|.:|:|....:.|.:|..........||..|..:|
 Worm   148 VRQIEDVLTAERINVDSARKRSIDVKQKPPLVKEMSLAKINLTPVLPEDIADLTSPVSEVSGQSK 212

  Fly   189 QLVA-IQGVIVTE---NTFPNDFYSKAPAMLIYTPNAVNSPKPVLLTHRNIEAQMRCLIGTWHLG 249
            :|.. ::..:|..   .|.......:.|.::::|.......|...|:||::...:: .|.....|
 Worm   213 ELNGDVESSVVDSEEVQTPIQQVSGQNPLLILFTSGTTGLAKAAELSHRSLIINIQ-QISLPLYG 276

  Fly   250 PTDC----MLPILSMNRMHAALAAVLSV--GGNVVLQQKFDGHNAWSALLGINSPSKQRVTLFLA 308
            |...    :|| ||:..::..::|..::  |.::.|                  .|||...||: 
 Worm   277 PVQTKERFLLP-LSIAHIYGIVSAYYALINGASLYL------------------ISKQSNRLFM- 321

  Fly   309 MPIVYKRLIVEYEKMFAKDSRMVEYIVNHCRQKIRLMATAFALLPDSVFYRWREITGQNIYEYYG 373
                                   |.:||:   :|.:|....|::      .|  :....|.:.|.
 Worm   322 -----------------------ETLVNN---QINVMHITPAIV------HW--MATDAIVDDYK 352

  Fly   374 M--METGLVLGHPLNKRQRDSPHNGPTAVAMANNTAPNDYRPG---------------------T 415
            .  :.:.|..|.|::..         :|.||.:.....|:|..                     :
 Worm   353 TPNLRSVLCAGAPIDSN---------SAAAMKSRLNIKDFRQSFGMTELGGICTMSPYLDEKIES 408

  Fly   416 LGSPLKGVTARLISNKGDELITCKNELGGSVDSGLIPVEDIGGDASLAGTIIGELQIAGSNLVSN 480
            :|:||.|:..::::.:..:|  |            :|.:.            |::.:.|..:...
 Worm   409 VGNPLPGMLFKVVNWETKQL--C------------LPRQP------------GQIIVLGPQVSPC 447

  Fly   481 TLANNNQEMEHKGTTNNEEQENNQDGFFKTGDICAYRN-GNFYFLSKSSDIFTVGGYKVYGSEIK 544
            ...|.....|....|          ||.||||...|.. |..|.|.:..||....|..:..||::
 Worm   448 YYKNPKATSELFDAT----------GFVKTGDAGFYDEVGRIYVLDRIKDIIKCKGTMICPSEVE 502

  Fly   545 KVLISHPNINDVAVLGIPNKMWG 567
            .||.:|..|:|.||:|..:.:.|
 Worm   503 LVLRAHAGIDDCAVVGRQDHVTG 525

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18155NP_996360.2 CaiC 53..604 CDD:223395 111/606 (18%)
AFD_class_I 58..607 CDD:302604 111/601 (18%)
mec-18NP_508731.3 CaiC 12..585 CDD:223395 113/609 (19%)
AFD_class_I 35..579 CDD:302604 111/598 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.