DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18155 and acs-10

Sequence 1:NP_996360.2 Gene:CG18155 FlyBaseID:FBgn0029945 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_506502.1 Gene:acs-10 WormBaseID:WBGene00007082 Length:566 Species:Caenorhabditis elegans

Alignment Length:645 Identity:129/646 (20%)
Similarity:229/646 (35%) Gaps:197/646 (30%)


  Fly     9 KLKLRPL-ARLCSAELIH----KDGFIEKLRHSFDEEERSNVVVPTFKKAMLYPDEIAVKDINGE 68
            ||..:|: .|:..:..||    ||..:      |.:.|       |..|..||.|.        |
 Worm    11 KLSTQPVHERILDSCRIHAAANKDAIV------FIDAE-------TTTKKKLYRDV--------E 54

  Fly    69 YTYFQLYMAAKRLGIQISNI--------------------CGGAALSNVTYLCSNNALWIAIQWS 113
            .|...|..|..:||.:..::                    ||| |:||.:.:.::..|.:..:  
 Worm    55 PTVNSLATALVKLGFKPGDVAAQAFPNCPEFLIAMLAVMKCGG-AMSNASAIFTDYELQLQFK-- 116

  Fly   114 CWISGQVAVPLESGQAIDQLQRQASNCK-TKLLIATKEFESLAQELSQGVKSATIILDHSFLPTA 177
               ....::.......:.:::|..:.|. .:.:|..:.| .|..|..:.|      ||  |:...
 Worm   117 ---DSNTSIVFTDEDRLARVRRSVAKCPGVRKIICLRTF-PLRAEFPENV------LD--FVELT 169

  Fly   178 ESVSSTSMYAKQLVAIQGVIVTENTFPNDFYSKAPAMLIYTPNAVNSPKPVLLTHRNIEAQM--- 239
            ::.....          .|:|:.:         |.|:|.|:......||...|||:||.|.:   
 Worm   170 QTPDQPI----------NVVVSPD---------AIALLPYSSGTTGRPKGCQLTHKNISAMLDIA 215

  Fly   240 ---------RCLIG----TWHLGPTDCMLPILSMNRMHAALAAVLSVGGNVVLQQKFDGHNAWSA 291
                     :.:.|    ||:......:||......::..|..:| :|...::.:|||      .
 Worm   216 QSHLETEVAQAMFGKEKPTWNKEHVLLLLPWYHAYGLNTMLETIL-LGATGLVFKKFD------T 273

  Fly   292 LLGINSPSKQRVTL-FLAMPIVYKRLIVEYEKMFAKDSRM-VEYIVNHCRQKIRLMATAFALLPD 354
            ::.:|.....:|.| :|..|::.         ..|||..: :..:..:.:..:...|||...|.:
 Worm   274 IVMLNRIKFYKVKLAWLVPPMLI---------FLAKDPMVPIFNVAPYLKVIMSAGATAGKQLCE 329

  Fly   355 SVFYR----WREITGQNIYEYYGMMETGLVLGHPLNKRQRDSPHNGPTAVAMANNTAPNDYRPG- 414
            .|..|    |       :.:.|||.|                         |...|....:..| 
 Worm   330 EVQKRFPNAW-------LCQAYGMTE-------------------------MVQFTTLPIFEHGN 362

  Fly   415 ---TLGSPLKGVTARLISNKGDELITCKNELGGSVDSGLIPVEDIGGDASLAGTIIGELQIAGSN 476
               |:||                       ||.:.:..::..|  |.:.....| :|:|...|..
 Worm   363 CFETVGS-----------------------LGPTYEMKILDKE--GKEVDKTDT-VGQLCFRGPT 401

  Fly   477 LVSNTLANNNQEMEHKGTTNNEEQE-NNQDGFFKTGDICAY-RNGNFYFLSKSSDIFTVGGYKVY 539
            ::             ||....||.: .::|||.||||:.:. :.|..:...:..::..|.|.:|.
 Worm   402 IM-------------KGYLKKEESDIIDKDGFLKTGDLGSVDQKGRVHVTGRIKELIKVNGMQVP 453

  Fly   540 GSEIKKVLISHPNINDVAVLGIPNKMWGHRLGVICIVSPDADIDLDAIKTYCYRHLPAHK 599
            ..||:.||:.||.:.|.||:|||::..|...... ||..|..:....:..:.::.|.::|
 Worm   454 PVEIEDVLLLHPKVKDCAVIGIPDEQKGESPRAY-IVKKDHTLTEAELSDFVHKMLSSYK 512

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18155NP_996360.2 CaiC 53..604 CDD:223395 117/597 (20%)
AFD_class_I 58..607 CDD:302604 115/592 (19%)
acs-10NP_506502.1 CaiC 17..544 CDD:223395 126/640 (20%)
Firefly_Luc_like 37..532 CDD:213279 121/620 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.