DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18155 and acs-14

Sequence 1:NP_996360.2 Gene:CG18155 FlyBaseID:FBgn0029945 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_505451.1 Gene:acs-14 WormBaseID:WBGene00008669 Length:544 Species:Caenorhabditis elegans

Alignment Length:590 Identity:130/591 (22%)
Similarity:212/591 (36%) Gaps:205/591 (35%)


  Fly    70 TYFQLYMAAKRLGIQISNI-----CGGAALSNVTYLCSNNALWIAIQWSCWISGQVAVPLESGQA 129
            |:.||...|..:.:.:.:|     .....|.||.:..|   .:|    .|.|:|. ||...|...
 Worm    49 TFEQLRKDAFAVAMYLHSIGFKKDVAAVVLPNVWHYTS---FFI----GCAINGG-AVSGASALF 105

  Fly   130 ID-QLQRQASNCKTKLLIATKEF---ESLAQELSQGVKSATIILD--HSFLPTAESVSSTSMYAK 188
            .| :||||..:.:.|::...::|   ..||.:.|..::...:|..  .|.|| |..||...:.:.
 Worm   106 TDYELQRQFVDSRAKVVFTYEDFLPKVLLAVKQSPNIQKIIVIPKPVGSSLP-AGVVSWNEVVST 169

  Fly   189 QLVAIQGVIVTENTFPNDFYSKAPAMLIYTPNAVNSPKPVLLTHRNIEAQMRCLIGTWHLGPTDC 253
            .:.|:..|       |.|.::.. .:|.|:......||.|:|:|.|.               |..
 Worm   170 PVTALPQV-------PIDVHNDL-LVLPYSSGTTGPPKGVMLSHYNF---------------TSM 211

  Fly   254 MLPILSMNRMHAALAAVLSVGGNVVLQQKFDGHNAWSALLGINSPSKQRVTLFLAMPIVYKRLIV 318
            :...|::::.|     :|.     ||...:|.:|             ::..|||....||.    
 Worm   212 ISMYLAIDKSH-----ILD-----VLDPNWDCYN-------------EKALLFLPFYHVYG---- 249

  Fly   319 EYEKMFAKDSRMVEYIVNHCRQKIRLMATAFALLPDSVFYRWREITGQNIYEYYGMMETGLVLGH 383
                 |.        ::|||..|                               ||  ||:|:.|
 Worm   250 -----FG--------LLNHCLLK-------------------------------GM--TGIVMSH 268

  Fly   384 PLNKRQRDSPHNGPTAVAMANNTAPNDY--RPGTLGSPLKGVTAR-LISNKGDELITCKNELGGS 445
                   ..|:|..|||        .:|  |...|..|:....|: .|.:|.| |.:.:..:.|:
 Worm   269 -------FEPNNFLTAV--------QNYKVRCLCLVPPIMVFLAKHPICDKFD-LSSVQMIMAGA 317

  Fly   446 VDSGLIPVEDIG---------------GDASLAGTI-----------IGELQIAGSNLVSNTLAN 484
            ..:|...:|::.               .:.|:|..:           :|:|   .||||      
 Worm   318 APAGKDLIEELKRKYTNLKYIQQGYGMTECSMASHLPDLRNDQPYGSVGKL---ASNLV------ 373

  Fly   485 NNQEMEHKGTTNNEEQENNQ---------------------------DGFFKTGDICAYRN--GN 520
              .::...||  :.||..||                           ||:..|||| .|.|  ||
 Worm   374 --MKIVEPGT--DREQPVNQRGEICVRGPTIMLGYLGRPEATASTVIDGWLHTGDI-GYLNEDGN 433

  Fly   521 FYFLSKSSDIFTVGGYKVYGSEIKKVLISHPNINDVAVLGIPNKMWGHRLGVICIVSPDADIDLD 585
            .:.:.:..::..|.|.:|..:|::.:|:|||.|.|.||:|||:...| .|....:|..|..:...
 Worm   434 LFIVDRLKELIKVKGLQVPPAELEDLLLSHPKIRDCAVIGIPDAKAG-ELPKAFVVRADNTLTEQ 497

  Fly   586 AIKTY 590
            .:|.:
 Worm   498 EVKDF 502

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18155NP_996360.2 CaiC 53..604 CDD:223395 130/591 (22%)
AFD_class_I 58..607 CDD:302604 130/591 (22%)
acs-14NP_505451.1 CaiC 12..539 CDD:223395 130/591 (22%)
Firefly_Luc_like 37..532 CDD:213279 130/591 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R434
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.