| Sequence 1: | NP_996360.2 | Gene: | CG18155 / 31668 | FlyBaseID: | FBgn0029945 | Length: | 610 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_505451.1 | Gene: | acs-14 / 179330 | WormBaseID: | WBGene00008669 | Length: | 544 | Species: | Caenorhabditis elegans | 
| Alignment Length: | 590 | Identity: | 130/590 - (22%) | 
|---|---|---|---|
| Similarity: | 212/590 - (35%) | Gaps: | 205/590 - (34%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    70 TYFQLYMAAKRLGIQISNI-----CGGAALSNVTYLCSNNALWIAIQWSCWISGQVAVPLESGQA 129 
  Fly   130 ID-QLQRQASNCKTKLLIATKEF---ESLAQELSQGVKSATIILD--HSFLPTAESVSSTSMYAK 188 
  Fly   189 QLVAIQGVIVTENTFPNDFYSKAPAMLIYTPNAVNSPKPVLLTHRNIEAQMRCLIGTWHLGPTDC 253 
  Fly   254 MLPILSMNRMHAALAAVLSVGGNVVLQQKFDGHNAWSALLGINSPSKQRVTLFLAMPIVYKRLIV 318 
  Fly   319 EYEKMFAKDSRMVEYIVNHCRQKIRLMATAFALLPDSVFYRWREITGQNIYEYYGMMETGLVLGH 383 
  Fly   384 PLNKRQRDSPHNGPTAVAMANNTAPNDY--RPGTLGSPLKGVTAR-LISNKGDELITCKNELGGS 445 
  Fly   446 VDSGLIPVEDIG---------------GDASLAGTI-----------IGELQIAGSNLVSNTLAN 484 
  Fly   485 NNQEMEHKGTTNNEEQENNQ---------------------------DGFFKTGDICAYRN--GN 520 
  Fly   521 FYFLSKSSDIFTVGGYKVYGSEIKKVLISHPNINDVAVLGIPNKMWGHRLGVICIVSPDADIDLD 585 
  Fly   586 AIKTY 590 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG18155 | NP_996360.2 | CaiC | 53..604 | CDD:223395 | 130/590 (22%) | 
| AFD_class_I | 58..607 | CDD:302604 | 130/590 (22%) | ||
| acs-14 | NP_505451.1 | CaiC | 12..539 | CDD:223395 | 130/590 (22%) | 
| Firefly_Luc_like | 37..532 | CDD:213279 | 130/590 (22%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0318 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R434 | 
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.840 | |||||