DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18155 and acs-7

Sequence 1:NP_996360.2 Gene:CG18155 FlyBaseID:FBgn0029945 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_495979.1 Gene:acs-7 WormBaseID:WBGene00007228 Length:540 Species:Caenorhabditis elegans

Alignment Length:602 Identity:124/603 (21%)
Similarity:207/603 (34%) Gaps:189/603 (31%)


  Fly    57 PDEIAVKDINGEYTYFQLYMAAKRLGIQISN--ICGGAALSNVTYLCSNNALWIAIQWSC----- 114
            ||.:|......|..........|:: :|||.  :..|....:|..|.|.|      .|.|     
 Worm    31 PDNVAFVTAENEDDSLGFQQLGKKV-LQISEWFVENGYKKGDVFLLASYN------NWRCFAAAL 88

  Fly   115 --WISGQVAVPLESGQAIDQLQRQASNCKTKLLIATKEFESLAQELS-QGVKSATIILDHSFLPT 176
              |.:|.:                       :..|..:|.|...... :..:|..|::|...||.
 Worm    89 GAWRAGLI-----------------------VSAAASQFTSFEMNYQIEDSQSQVILVDKHTLPV 130

  Fly   177 AESVSSTSMYAKQLVAIQG---------VIVTENTFPNDFYSKAP--------AMLIYTPNAVNS 224
            .:.......:.||:::|..         .::|.....|   .|.|        ..|.|:......
 Worm   131 VQEACKNLKFVKQIISISANPPSPVIKFDVLTSRLVRN---LKMPLIDPKNDIVFLPYSSGTTGK 192

  Fly   225 PKPVLLTHRN----IEAQMRCL------IGTWHLGPTDCMLPI-LSMNRMHAALAAVLSV----- 273
            ||.|:::|.|    :|:.:|..      ||.    |.|.:||. |....|:.|:....::     
 Worm   193 PKGVMISHLNFSMMLESSLRFFDANAKAIGL----PPDFVLPYDLHFLPMYHAMGMFRTLLTSYR 253

  Fly   274 GGNVVLQQKFDGHNAWSALLGINSPSKQRVTLFLAMPIVYKR-----LIVEYEKMFAKDSRMVEY 333
            |...::..|||..      |.:.:..|..:.:...:|.:..|     |:.:|:         |..
 Worm   254 GTTQIMFTKFDME------LMLKNIEKYSIMVLSLVPAIAVRMLNSPLLQKYD---------VSS 303

  Fly   334 IVNHCRQKIRLMATAFALLPDSVFYRWRE-ITGQNIYEYYGMMETGLVLGHPLNKRQRDSPHNGP 397
            :|:        :....|..|:|...:.:: :...||.:.|||.|  |.....|     .||    
 Worm   304 LVS--------VTVGSAPFPESASKKLKQLLPNVNIVQGYGMTE--LTFATHL-----QSP---- 349

  Fly   398 TAVAMANNTAPNDYRPGTLGSPLKGVTARLISNKGDELITCKNELGGSVDSGLIPVEDIGGDASL 462
                               ||| .|...||:....   :..|.|                 |.:|
 Worm   350 -------------------GSP-DGSVGRLVPGTS---MKVKKE-----------------DGTL 374

  Fly   463 AGT-IIGELQIAGSNLVSNTLANNNQEMEHKGTTNNEEQEN---NQDGFFKTGDICAY-RNGNFY 522
            .|. .||||.|.|..::             ||....|:|.|   ::.||.:||||..: :||..:
 Worm   375 CGPHEIGELWIKGPQMM-------------KGYWKKEQQTNELLDEHGFMRTGDIVYFDKNGETF 426

  Fly   523 FLSKSSDIFTVGGYKVYGSEIKKVLISHPNINDVAVLGIPNKMWGHRLGVICIVSPDADIDLDAI 587
            ...:..::..|...:|..:|::.|::.|.::.||.|.|:.:...|.| .|.|:||.... |::..
 Worm   427 ICDRIKELIKVNAKQVAPAELESVILEHDDVADVCVFGVDDASSGER-PVACVVSKRGR-DMETS 489

  Fly   588 KTYC---------YRHL 595
            |...         |:|:
 Worm   490 KAIMKHINQKLARYKHI 506

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18155NP_996360.2 CaiC 53..604 CDD:223395 124/603 (21%)
AFD_class_I 58..607 CDD:302604 123/602 (20%)
acs-7NP_495979.1 CaiC 12..540 CDD:223395 124/603 (21%)
Firefly_Luc_like 35..524 CDD:213279 122/599 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.