DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18155 and acs-11

Sequence 1:NP_996360.2 Gene:CG18155 FlyBaseID:FBgn0029945 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_494848.3 Gene:acs-11 WormBaseID:WBGene00018269 Length:505 Species:Caenorhabditis elegans

Alignment Length:553 Identity:111/554 (20%)
Similarity:202/554 (36%) Gaps:138/554 (25%)


  Fly    43 SNVVVPTFKKAMLYPDEIAVKDINGE--YTYFQLYMAAKRLGIQISNIC-------GGAALSNVT 98
            :|:|    .:|.|..|...:..|:|:  .||.:.   .||.|...:.:.       |...::.|:
 Worm    23 NNIV----SQAQLQSDPSKLLFIDGDRKTTYGEF---VKRTGQYATALTEKYNIKKGDRVMARVS 80

  Fly    99 YLCSNNALWIAIQWSCWISGQVAVPLESGQAIDQLQRQASNCKTKLLIATKEFESLAQELSQGVK 163
            ......||:||    |...|.:.:|:..|....:......:....:|::..|      ||.:..:
 Worm    81 KTTDTAALYIA----CLQIGALYIPVNPGYTESEAAHYIKDATPSILVSCNE------ELDKVFR 135

  Fly   164 SATIILDHSFLPTAESVSSTSMYAKQLVAIQGVIVTENTFPNDFYSKAPAMLIYTPNAVNSPKPV 228
            ....:::...|            |.:..::....:.|:...:|     ||.:.||......||..
 Worm   136 DKIRVINEDKL------------ASEAGSLNACTMIEHVEKSD-----PASVCYTSGTTGLPKGA 183

  Fly   229 LLTHRNIEAQMRCLIGTWHLGPTDC---MLPILSMNRMHAALAAVLSVGGNVVLQQKFDGHNAWS 290
            :|||.::......::..|.....|.   .||...::.::.:|...|.....::.:.||:..:...
 Worm   184 ILTHGSLSNNAHDIVRDWGFTGNDYNLHALPFYHVHGLYYSLHCSLFSHSTMIWRSKFEVEDCIK 248

  Fly   291 ALLGINSPSKQRVTLFLAMPIVYKRLIVEYEKMFAKDSRMVEYIVNHCRQKIRLMATAFALLPDS 355
            .:        :..|:.:.:|..:.||:.  .|.|.|::          ...:|:..:..|.|..|
 Worm   249 YM--------KNATVMMGVPTFFSRLLA--SKNFNKEA----------FGNVRVFISGSAPLSVS 293

  Fly   356 VFYRWREITGQNIYEYYGMMETGLVLGHPLNKRQRDSPHNGPTAVAMANNTAPNDYRPGTLGSPL 420
            ....:||.|||.|.|.|||.|.|::..:|||                      .:.:.||:|..:
 Worm   294 TIEEFRERTGQVILERYGMTEAGVMTTNPLN----------------------GERKAGTVGPAV 336

  Fly   421 KGVTARLISNKGDELITCKNELGGSVDSGLIPVEDIGGDASLAGTIIGELQIAGSNLVSNTLANN 485
            :||..|:..|.|.|:.|                     :|..||                     
 Worm   337 QGVGCRIAKNGGIEVKT---------------------NAIFAG--------------------- 359

  Fly   486 NQEMEHKGTTNNEEQENNQDGFFKTGDICAY-RNGNFYFLSKSSDIFTVGGYKVYGSEIKKVLIS 549
                 :........:|..:||:|||||:... .:|......:|.|:...||..||..|::..:.:
 Worm   360 -----YWKNPKKTAEEFTEDGWFKTGDVGHLDEDGYLTIGGRSKDMVITGGLNVYPKELEDFIDT 419

  Fly   550 HPNINDVAVLGIPNKMWGHRLGVICIVSPDADI 582
            .|.:.:.||:..|:..:|.  .|:.||.|...:
 Worm   420 LPFVKESAVIASPHPDFGE--AVVAIVVPSEKV 450

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18155NP_996360.2 CaiC 53..604 CDD:223395 109/544 (20%)
AFD_class_I 58..607 CDD:302604 107/539 (20%)
acs-11NP_494848.3 PRK07514 34..505 CDD:181011 107/539 (20%)
MCS 37..493 CDD:213307 106/536 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C320562409
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D229996at33208
OrthoFinder 1 1.000 FOG0003173
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_129266
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.889 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R434
TreeFam 00.000 Not matched by this tool.
76.780

Return to query results.
Submit another query.