DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18155 and C32E8.6

Sequence 1:NP_996360.2 Gene:CG18155 FlyBaseID:FBgn0029945 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_740831.1 Gene:C32E8.6 WormBaseID:WBGene00016324 Length:461 Species:Caenorhabditis elegans

Alignment Length:525 Identity:95/526 (18%)
Similarity:172/526 (33%) Gaps:178/526 (34%)


  Fly    97 VTYLCSNNALWIAIQWSCWISGQVAVPLESGQAIDQLQRQASNCKTKLLIATKE-----FESLAQ 156
            :...|:|:...:||..:..:||...:||.......::....|......:|.:.:     ||....
 Worm    58 IALFCTNSPDILAIIVAGQLSGVTVIPLNPSYKKYEIDEYISKSIANFIIVSDDVDLDKFEEREV 122

  Fly   157 ELSQGVKSATIILDHSFLPTAESVSSTSMYAKQLVAIQGVIVTENTFPNDFYSKAPAMLIYTPNA 221
            .|...:.::.:        |..|.:||.       ..|||||        |:|.         ..
 Worm   123 NLISELFTSNV--------TPSSTASTP-------ENQGVIV--------FFSS---------GT 155

  Fly   222 VNSPKPVLLTHRNIEAQMRCLIGTWHLGP------TD--C--MLPILSMNRMHAALAAVLSVGGN 276
            ...||....|.|.:.:|:. .|......|      ||  |  :||......:...|:.:.| |..
 Worm   156 TGPPKQFEYTQRILCSQID-QIKAIRSDPRFFSPSTDDICYGVLPFFHAGGLITILSMIFS-GCT 218

  Fly   277 VVLQQKFDGHNAWSALLGINSPSKQRVTLFLAMPIVYKRLIVEYEKMFAKDSRMVEYIVNHCRQK 341
            |::.::::.|...:     |..:.:...|||..|::         ..||....:..|.::..:  
 Worm   219 VLINERWNEHEFLA-----NCQNYKVSVLFLVPPVL---------NFFANHPLVSSYDLSALK-- 267

  Fly   342 IRLMATAFALLPDS---VFYRWREITGQNIYEYYGMMETGLVLGHPLNKRQRDSPHNGPTAVAMA 403
             .:...|.|..|::   |..|..|:  :|:.:.||..|.|::|                      
 Worm   268 -TIYVGAAASPPENFAKVAERLPEL--ENLIQLYGTSECGVLL---------------------- 307

  Fly   404 NNTAPNDYRPGTLGSPLKGVTARLISNKGDELITCKNELGGSVDSGLIPVEDIGGDASLAGTIIG 468
                                              |..                 |....:|..:|
 Worm   308 ----------------------------------CST-----------------GKGKASGKTVG 321

  Fly   469 ------ELQIAGSNLVSNTLANNNQEMEHKGTTNNEEQENNQDGFFKTGDI-C-AYRNGNFYFLS 525
                  ||:|          ...|.|:..|..|..||      ||.:|||: | :::......:.
 Worm   322 WPFPFVELKI----------NPENNEIFVKSATAMEE------GFMETGDLGCLSFKTIELMIVG 370

  Fly   526 KSSDIFTVGGYKVYGSEIKKVLISHPNINDVAVLGIPNKMWGHRLGVICIVSPDADIDL-----D 585
            :|.::..:.|::|..:|::.|:.....:.|.||.....|:....:|     :||:..|:     |
 Worm   371 RSKEMMKIRGWQVNPNEVEDVIRKVEGVLDCAVYQNQEKLTAKIIG-----NPDSKADIFKIVKD 430

  Fly   586 AIKTY 590
            .:.:|
 Worm   431 NLASY 435

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18155NP_996360.2 CaiC 53..604 CDD:223395 95/526 (18%)
AFD_class_I 58..607 CDD:302604 95/526 (18%)
C32E8.6NP_740831.1 CaiC 8..457 CDD:223395 95/526 (18%)
AFD_class_I 57..455 CDD:302604 95/526 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.