DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18155 and dip2a

Sequence 1:NP_996360.2 Gene:CG18155 FlyBaseID:FBgn0029945 Length:610 Species:Drosophila melanogaster
Sequence 2:XP_009302675.1 Gene:dip2a ZFINID:ZDB-GENE-091204-2 Length:1589 Species:Danio rerio

Alignment Length:646 Identity:119/647 (18%)
Similarity:206/647 (32%) Gaps:224/647 (35%)


  Fly    70 TYFQLYMAAKRLGIQISNICGGAALSN-----------VTYLCSNN--ALWIAIQWSCWISGQVA 121
            ||.:|:..:::|...:.|     .||:           |..:..||  .:::...:.|.::..|.
Zfish   385 TYGKLWTRSQKLAFTLLN-----KLSSRNEPLLRPGDRVALVFPNNDPVMFMVAFYGCLLAELVP 444

  Fly   122 VPLE--------SGQAIDQLQRQASNCKTKLLIATKEFESLAQELSQGVKSATIILDHSFLPTAE 178
            ||:|        .||.:..|   ..:|...|.:.|       ....:|            ||.|:
Zfish   445 VPIEVPLTRKDAGGQQVGFL---LGSCGVTLALTT-------DACQKG------------LPKAQ 487

  Fly   179 SVSSTSMYAKQLVAIQG-----VIVTENTF----PNDFY------SKAPAMLIYTPNAVNSPKPV 228
            :        .::|..:|     ..||:...    |.|::      |...|.:.|......|...|
Zfish   488 T--------GEVVTFKGWPRLLWFVTDGKHVVKPPKDWHPPIRDASNEIAYIEYKTGKEGSTMGV 544

  Fly   229 LLTHRNIEAQMRCL---------------------IGTWHLGPTDCMLPILS--MNRMHAALAAV 270
            .::|..:.|....|                     .|.||        .:|:  |||||     |
Zfish   545 TVSHSAMLAHCHALTQACGYTEGEVITNVLDFKRDAGLWH--------GVLTSVMNRMH-----V 596

  Fly   271 LSVGGNVVLQQKFDGHNAWSALLGINSPS-KQRVTLFLAMPIVYKRLIVEYEKMFAKDSRMVEYI 334
            :|:.               .:|:.:|..| .|:|..:.|...|.|...:.:..:..:|.|.:.. 
Zfish   597 ISIP---------------YSLMKVNPLSWIQKVHTYKARVAVVKSRDMHWSLLAQRDQRDISL- 645

  Fly   335 VNHCRQKIRLMATAFALLPDSV-----FYRWREITGQNIYEYYGMMETGLV----LGHPLNKRQR 390
                 ..:|::..|....|.|:     |.        |:::..|:....:.    ....|....|
Zfish   646 -----SSLRMLIVADGANPWSISSCDAFL--------NVFQSRGLRPEVICPCASSSEALTVAIR 697

  Fly   391 DSPHNGPTAVAMANNTAPNDYRPGTLGSPLKGVTARLISNKGDELIT--CKNELGGSVDSGLIPV 453
            ..|..|         ..|    ||.....:.|::..:|....:|.::  ...:.|..:..||:.|
Zfish   698 RPPETG---------VPP----PGKAVLSMSGLSYGVIRVDTEEKLSVLTVQDAGQVMPGGLVCV 749

  Fly   454 EDIGGDASLAGT-IIGELQIAGSNLVSNTLANNNQEMEHKGTTNNEEQENNQDGFFKT------- 510
            ..:.|...|..| .:||:.::     |:|...:...:  .|.|.|         .|:|       
Zfish   750 IRVEGTPYLCRTDEVGEICVS-----SSTTGISYYGL--PGMTKN---------VFETIPVTSSG 798

  Fly   511 ---GDICAYRNGNFYFLSKSSDIFTVGGYKVYGSEIKKVLISHPNINDVAVLGI---PNK----- 564
               .|....|.....|:...:.:|.||  |:.|  :..|.....|.:||....:   |.|     
Zfish   799 APISDRAFTRTSLLGFIGPDNLVFVVG--KLDG--LMVVSGRRHNADDVVATALAVEPMKFVYRG 859

  Fly   565 ---------MWGHRLGVICIVSPDAD--------------ID-LDAIKTYCYRHLPAHKCP 601
                     :...|:.|:....|||.              || :..:..||...:||:..|
Zfish   860 RIAVFSVSVLHDERIVVVAEQRPDASEEDSFQWMSRVLQAIDSIHQVGVYCLALVPANTLP 920

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18155NP_996360.2 CaiC 53..604 CDD:223395 119/647 (18%)
AFD_class_I 58..607 CDD:302604 119/647 (18%)
dip2aXP_009302675.1 DMAP_binding 19..132 CDD:283995
CaiC 349..927 CDD:223395 119/647 (18%)
AFD_class_I 375..939 CDD:302604 119/647 (18%)
AMP-binding 1009..1483 CDD:278902
AFD_class_I 1026..1578 CDD:302604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.