DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18155 and acsf3

Sequence 1:NP_996360.2 Gene:CG18155 FlyBaseID:FBgn0029945 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_001121382.2 Gene:acsf3 XenbaseID:XB-GENE-964811 Length:589 Species:Xenopus tropicalis

Alignment Length:579 Identity:163/580 (28%)
Similarity:278/580 (48%) Gaps:93/580 (16%)


  Fly    43 SNVVVPTFKKAMLYPDEIAVKDINGEYTYFQLYMAAKRLGIQISNICGGAALSN----VTYLCSN 103
            |:.|||.|.:|..:.:..|:.|.:|::||.:||:.::.|...|..:.|..:.:|    |::||.|
 Frog    52 SSHVVPVFSRAPFFSERTAMVDQHGKHTYKELYIRSQALSKMIIQLLGHPSRNNPPERVSFLCPN 116

  Fly   104 NALWIAIQWSCWISGQVAVPLESGQAIDQLQRQASNCKTKLLIATKEFESLAQELSQGVKSATII 168
            |:.::..||:.|:||.:||||.......:|:....:.::.|::|.:.:.::...|::.:.     
 Frog   117 NSSYVVCQWAVWMSGAIAVPLYKSHPPSELKYILQDSQSALVVAEESYANVMNPLAEQLG----- 176

  Fly   169 LDHSFLPTAESVSSTSMYAKQLVAIQGVIVTENTFPNDFYSKAPAMLIYTPNAVNSPKPVLLTHR 233
                 :|......|.|::..:|  :|.:.|::  ...|:..:. ||:|||......||.||.||.
 Frog   177 -----IPVLTMSGSQSLHPSEL--LQEIEVSK--LELDWKDRG-AMIIYTSGTTGRPKGVLSTHY 231

  Fly   234 NIEAQMRCLIGTWHLGPTDCMLPILSMNRMHAA---LAAVLSVGGNVVLQQKFDGHNAWSALLGI 295
            |:.:.:..|:..|.....|.:|.:|.::.:|..   |...|.||...|:...|.....|...|..
 Frog   232 NLYSMVSALVTEWGWTKEDSILHVLPLHHVHGVVNKLMCPLWVGATCVMLPDFCPQKVWQHFLRR 296

  Fly   296 NSPSKQRVTLFLAMPIVYKRLIVEYEKMFAKDSRMVEYIVNHCRQKIRLMATAFALLPDSVFYRW 360
            ::||   :.:|:|:|.:|.:||..||:.|. .|.:.|::...|:::||||.:..:.||..:..||
 Frog   297 DAPS---INIFMAVPTIYSKLISYYEQHFT-HSNVREFVRAACQERIRLMVSGSSALPVPILERW 357

  Fly   361 REITGQNIYEYYGMMETGLVLGHPLNKRQRDSPHNGPTAVAMANNTAPNDYRPGTLGSPLKGVTA 425
            :||||..:.|.|||.|.|:.|.:||         :||..             ||.:|:||.||..
 Frog   358 QEITGHTLLERYGMTEIGMALTNPL---------HGPRV-------------PGAVGNPLPGVEV 400

  Fly   426 RLISNKGDELITCKNELGGSVDSGLIPVEDIGGDASLAGTII--------GELQIAGSNLVSNTL 482
            |.::....:             .|........||::  ||::        ||||:.|..:..   
 Frog   401 RTVTQNPRK-------------EGTSYTVHAHGDST--GTMVSVGLENREGELQVQGPAVFK--- 447

  Fly   483 ANNNQEMEHKGTTNNEEQENNQDGFFKTGDICAYRNGNFYFLSKSS-DIFTVGGYKVYGSEIKKV 546
                   |:....:..::....||:|||||...|::|.::.|.::| ||...|||||...|:::.
 Frog   448 -------EYWNKPHETQEAFTSDGWFKTGDTAVYKDGTYWILGRTSVDIIKSGGYKVSALEVERH 505

  Fly   547 LISHPNINDVAVLGIPNKMWGHRLGVICIVSPDADIDLDAIK--------TYCYRHLPA 597
            |:.||:|.||||:|.|:..||.|:..|..:.....:.|..:|        .||   :||
 Frog   506 LLGHPSITDVAVIGAPDVTWGQRVAAIVKLRDGHALSLQELKEWARAVMAPYC---IPA 561

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18155NP_996360.2 CaiC 53..604 CDD:223395 158/570 (28%)
AFD_class_I 58..607 CDD:302604 157/565 (28%)
acsf3NP_001121382.2 CaiC 61..582 CDD:223395 158/571 (28%)
MCS 67..579 CDD:213307 157/565 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C321099480
eggNOG 1 0.900 E1_COG0318
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 234 1.000 Inparanoid score I3188
OMA 1 1.010
OrthoDB 1 1.010 D229996at33208
OrthoFinder 1 1.000 FOG0003173
OrthoInspector 1 1.000 T1059238
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R434
TreeFam 1 0.960
1110.800

Return to query results.
Submit another query.