DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Inx6 and ogre

DIOPT Version :8

Sequence 1:NP_572374.1 Gene:Inx6 / 31645 FlyBaseID:FBgn0027107 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_001245557.1 Gene:ogre / 45382 FlyBaseID:FBgn0004646 Length:362 Species:Drosophila melanogaster

Alignment Length:412 Identity:113/413 (27%)
Similarity:186/413 (45%) Gaps:72/413 (17%)


  Fly     1 MYAAVKPLSNYLRLKTVRIYDPIFTLHSKCTIVILLTCTFLLSAKQYFGEPILCLSSERQADYVQ 65
            ||..:..|.:||:.:.::..:.:|.||:..|.|:||||:.:::|.||.|:||.|:.:......|.
  Fly     1 MYKLLGSLKSYLKWQDIQTDNAVFRLHNSFTTVLLLTCSLIITATQYVGQPISCIVNGVPPHVVN 65

  Fly    66 SYCWTMGTYILPAEVDRDGGSSWEYALYAPTSTAAETFNVSSLRALVAQNEQYARFISIAEGVGP 130
            ::||...|:.:|....|..|....:.                               .:|...|.
  Fly    66 TFCWIHSTFTMPDAFRRQVGREVAHP-------------------------------GVANDFGD 99

  Fly   131 ETRGVTKRMYLRYYQWVFMILLFQSLLFYFPSFLWKVWEGQRMEQLCCEVGDALIV----EATYR 191
            |    ..:.|..|||||..:|.||::..|.|.|||..:||..|..:...:...:..    ||...
  Fly   100 E----DAKKYYTYYQWVCFVLFFQAMACYTPKFLWNKFEGGLMRMIVMGLNITICTREEKEAKRD 160

  Fly   192 TRLQMLTRYFRAQFAPIHWCYSIKYAFCELLNVFISILNFWLMDVVFNGFWYKY---IHALAAIP 253
            ..|..|.::.:.     |..|:|:|..||.|.....|:..:||:..|:|.:..|   |..|:.:|
  Fly   161 ALLDYLIKHVKR-----HKLYAIRYWACEFLCCINIIVQMYLMNRFFDGEFLSYGTNIMKLSDVP 220

  Fly   254 --------VYDWNLWNLMTSRVFPKVAKCEMFVYGPSGTPNIMDILCVLPLNILNEKIFAVLYVW 310
                    ||           |||:|.||....|||||:....|.||:|||||:|||.:..::.|
  Fly   221 QEQRVDPMVY-----------VFPRVTKCTFHKYGPSGSLQKHDSLCILPLNIVNEKTYVFIWFW 274

  Fly   311 FLFIALLAIMNILYRLLVICCPELRLQLLRTHLNGMPKSHVREVLASAGYGDWFVLMCVSINVNP 375
            |..:.:|.|..|::|..:|..|:.|.:||......:|....|.:......|||:::..:..|::|
  Fly   275 FWILLVLLIGLIVFRGCIIFMPKFRPRLLNASNRMIPMEICRSLSRKLDIGDWWLIYMLGRNLDP 339

  Fly   376 TLFRELLEQLYAKLNQARCTEP 397
            .::::::.:.      |:..||
  Fly   340 VIYKDVMSEF------AKQVEP 355

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Inx6NP_572374.1 Innexin 21..389 CDD:279248 105/383 (27%)
ogreNP_001245557.1 Innexin 20..351 CDD:279248 106/388 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2BWHM
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I3116
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D323554at33208
OrthoFinder 1 1.000 FOG0000263
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11893
RoundUp 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.