DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Inx6 and Inx3

DIOPT Version :8

Sequence 1:NP_572374.1 Gene:Inx6 / 31645 FlyBaseID:FBgn0027107 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_001263050.1 Gene:Inx3 / 44266 FlyBaseID:FBgn0265274 Length:395 Species:Drosophila melanogaster

Alignment Length:399 Identity:110/400 (28%)
Similarity:184/400 (46%) Gaps:44/400 (11%)


  Fly     1 MYAAVKPLSNYLRLKTVR----IYDPIFTLHSKCTIVILLTCTFLLSAKQYFGEPILCLSSER-Q 60
            ::..|..:|.:::::.:.    |.:.:|..|.:.|..||.||..:::|....|:||.|::... .
  Fly     3 VFGMVSAVSGFIKIRYLLDKAVIDNMVFRCHYRITTAILFTCCIIVTANNLIGDPISCINDGAIP 67

  Fly    61 ADYVQSYCWTMGTYILPAEVDRDGGSSWEYALYAPTSTAAETFNVSSLRALVAQNEQYARFISIA 125
            ...:.::||...||.:|.:..|..|:.                        ||           .
  Fly    68 MHVINTFCWITYTYTIPGQQHRQIGTD------------------------VA-----------G 97

  Fly   126 EGVGPETRGVTKRMYLRYYQWVFMILLFQSLLFYFPSFLWKVWEGQRMEQLCCEVGDALIVEATY 190
            .|:|.| .|..|| |..|||||..:|.||.|:||.|.::||..|..::..:...:...:.|...|
  Fly    98 PGLGNE-YGQEKR-YHSYYQWVPFVLFFQGLMFYVPHWVWKNMEDGKIRMITDGLRGMVSVPDDY 160

  Fly   191 -RTRLQMLTRYFRAQFAPIHWCYSIKYAFCELLNVFISILNFWLMDVVFNGFWYKYIHALAAIPV 254
             |.|...:.:|| ......|..||..|.||||||....|:|.:::|....|.:..|...:.....
  Fly   161 RRDRQDRILKYF-VNSLNTHNGYSFAYFFCELLNFINVIVNIFMVDKFLGGAFMSYGTDVLKFSN 224

  Fly   255 YDWNLWNLMTSRVFPKVAKCEMFVYGPSGTPNIMDILCVLPLNILNEKIFAVLYVWFLFIALLAI 319
            .|.:........:||::.||....:||||:....|.||||.||||||||:..|:.||:.:|.::.
  Fly   225 MDQDKRFDPMIEIFPRLTKCTFHKFGPSGSVQKHDTLCVLALNILNEKIYIFLWFWFIILATISG 289

  Fly   320 MNILYRLLVICCPELRLQLLRTHLNGMPKSHVREVLASAGYGDWFVLMCVSINVNPTLFRELLEQ 384
            :.:||.|:||..|..|..:::.......:..:..::.....||:.:|..:|.|::...:.::|:|
  Fly   290 VAVLYSLVVIMMPTTRETIIKRSYRSAQRKEIAGLVRRLEIGDFLILHFLSQNLSTRSYSDMLQQ 354

  Fly   385 LYAKLNQAR 393
            |...|..:|
  Fly   355 LCGLLGASR 363

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Inx6NP_572374.1 Innexin 21..389 CDD:279248 105/370 (28%)
Inx3NP_001263050.1 Innexin 26..356 CDD:279248 105/368 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2BWHM
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I3116
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D323554at33208
OrthoFinder 1 1.000 FOG0000263
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11893
RoundUp 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.