DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Inx6 and che-7

DIOPT Version :8

Sequence 1:NP_572374.1 Gene:Inx6 / 31645 FlyBaseID:FBgn0027107 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_001317771.1 Gene:che-7 / 184979 WormBaseID:WBGene00000488 Length:563 Species:Caenorhabditis elegans

Alignment Length:543 Identity:117/543 - (21%)
Similarity:198/543 - (36%) Gaps:166/543 - (30%)


  Fly    31 TIVILLTCTFLLSAKQYFGEPILC-----LSSERQADYVQSYCWTMGTYILPAEVDRDGGSSWEY 90
            |...|:....|:|.||:.|.|:.|     .::..:| |.:.|||...||.:|  :|:|       
 Worm    72 TSSFLIMMAVLVSFKQFGGRPLECWVPAQFTASWEA-YTEMYCWAQNTYWVP--IDQD------- 126

  Fly    91 ALYAPTSTAAETFNVSSLRALVAQNEQYARFISIAEGVGPETRGVTKRMY--LRYYQWVFMILLF 153
               .|..                                     :::|.|  :.|||||...||.
 Worm   127 ---IPVD-------------------------------------ISEREYRQISYYQWVPFFLLL 151

  Fly   154 QSLLFYFPSFLWKVW---EGQRMEQLCCEVGDALIVEATYRTR-LQMLTRYF------------R 202
            |:.|:|.|..:|::.   .|.|:..:.....:...:|..||.| ::.|:|:.            |
 Worm   152 QAFLYYIPCLMWRLMSDKSGIRLNDIVQMATEKENIEPDYRIRTIESLSRHIESALRYQHTATSR 216

  Fly   203 AQFA--PIHWCYSIKYAFCELLNVFIS-----ILNFWLMDVVFNGFWYKYIHALAAIPVYDWNLW 260
            .|:.  .:..|::::|....:..::::     :.|.....|:.|.|.....:::..:.|    |.
 Worm   217 TQYTLHRVFKCFNMRYYESYVTGMYLATKIMYVGNILTNLVLVNKFLETDEYSIYGLGV----LR 277

  Fly   261 NLMTSRV------FPKVAKCEMFVYGPSGTPNIMDILCVLPLNILNEKIFAVLYVWFLFIALLAI 319
            :|:..|.      ||:|..|: |.....|......:.|||.:||.|||||.::::||..:.:.:.
 Worm   278 DLLFGRTWIESGNFPRVTLCD-FEVRVLGNNQRHSVQCVLVINIFNEKIFILIWLWFTLLFVAST 341

  Fly   320 MNILY----------------RLLVICC----PEL-----RLQL---LRTHLNGMPKSHVREVLA 356
            :::||                |.|.:..    |||     |.|:   |||:|.......:|.:..
 Worm   342 LDMLYWFSISMFHRDRFRFVLRHLELTSDPDKPELFRKEKRKQVEHFLRTYLKVDGVLVLRMIAL 406

  Fly   357 SAGYGDWFVLMCVSINVNPTLFRELLEQ-------------LYAKLNQARCTEPVFAEQPCQQVP 408
            .||     |:.|..|  ...|::..|.|             .:|:....|......:....|...
 Worm   407 HAG-----VMFCTEI--TDALWKRYLSQHPENLIDDDSSLITFARAQSIRRKRNDSSNSDGQNHQ 464

  Fly   409 QLAQVPQLFSHA------KLDRCPSRNCSLLID-----------------PTADRHSICTESSHR 450
            :|.::   .||.      :|:|..|.|.||..:                 |.....|.|:....:
 Worm   465 RLGRI---LSHRSTGGSFRLNRTQSTNRSLNTENKTGAATGSNAAASPNTPPPVPKSACSSRFGK 526

  Fly   451 VTAMPTAPTLNLMAPNDEIISMD 473
            |....|..|:| ...||...|.|
 Worm   527 VKPRRTVVTIN-SQQNDARTSPD 548

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Inx6NP_572374.1 Innexin 21..389 CDD:279248 95/434 (22%)
che-7NP_001317771.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2BWHM
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I3116
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D323554at33208
OrthoFinder 1 1.000 FOG0000263
OrthoInspector 1 1.000 T97983
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11893
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.