DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Inx6 and inx-7

DIOPT Version :8

Sequence 1:NP_572374.1 Gene:Inx6 / 31645 FlyBaseID:FBgn0027107 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_500894.1 Gene:inx-7 / 177364 WormBaseID:WBGene00002129 Length:556 Species:Caenorhabditis elegans

Alignment Length:462 Identity:99/462 - (21%)
Similarity:167/462 - (36%) Gaps:121/462 - (26%)


  Fly    21 DPIFTLHSKCTIVILLTCTFLLSAKQYFGEPILCL----SSERQADYVQSYCWTMGTYILPAEVD 81
            |.:.::||..|..:|:....|:|.||:.|.||.|:    .:.....|..:|||...||.:|    
 Worm    20 DLVASIHSFLTSNLLVGLAVLISWKQFGGTPIECMVPLDFTSAWVQYSNNYCWAQPTYFIP---- 80

  Fly    82 RDGGSSWEYALYAPTSTAAETFNVSSLRALVAQNEQYARFISIAEGVGPETRGVTK-RMYLRYYQ 145
                                 |....:..:|...:..|..|:|..| |...|.|.| ...:.|||
 Worm    81 ---------------------FTEELVEQVVDPADVVADGITIGNG-GNRPRFVKKGGEKISYYQ 123

  Fly   146 WVFMILLFQSLLFYFPSFLWKVWEGQ-------------------------RMEQLCCEVGDALI 185
            |:...|||::..|..|.|:||.:..|                         .::.||..:...| 
 Worm   124 WMSFFLLFEAACFRLPCFIWKYFASQSGMQVGEILRVASDENNAVPLVKKANIDALCIHLRGVL- 187

  Fly   186 VEATYRTRLQM-------LTRYFRAQFAP--IHWCYSI-KYAFCELLNVFI--SILNFWLMDVVF 238
               .::.||::       :.|:...:::.  :.:.|.: |.||  ||||.:  .:||        
 Worm   188 ---RFQKRLKLKKIVPHKILRFLNIKYSAYYVTFIYFVAKVAF--LLNVILQSKLLN-------- 239

  Fly   239 NGFWYKYIHALAAIPVYDWNLWNLM------------TSRVFPKVAKCEMFVYGPSGTPNIMDIL 291
                 ||:........:.:::|..:            .:.|||:|..|: |.....|...:..:.
 Worm   240 -----KYMLPHDRQQNFGFDMWKTIFYGSTNGNETWRENGVFPRVTLCD-FETRDMGNVQMHTVQ 298

  Fly   292 CVLPLNILNEKIFAVLYVWFLFIALLAIMNILYRLLVICCPELRLQLLRTHLNGMP--------- 347
            |||.||:..||||..|:.|::.:....:.|:...|..:.........:..||....         
 Worm   299 CVLLLNLFTEKIFVFLWAWYILLTAFTVGNLFSWLFAVFNETYNEHFILNHLEMCETPFDKDDLK 363

  Fly   348 -KSHV-REVLASAGYGDWFVLMCVSINVNPTLFRELLEQLY----------AKLNQARCTEPVFA 400
             :.|| |.:....|....|:|..::.:.:.....||:..|:          |.|.|.....|:..
 Worm   364 NREHVTRFITLYLGTDGLFLLQLIAQHADVVFTTELIAALFKTYIEIEAQRATLKQMNAVLPLLR 428

  Fly   401 EQPCQQV 407
            .....||
 Worm   429 PNDESQV 435

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Inx6NP_572374.1 Innexin 21..389 CDD:279248 94/442 (21%)
inx-7NP_500894.1 Innexin 20..407 CDD:279248 93/432 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2BWHM
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I3116
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D323554at33208
OrthoFinder 1 1.000 FOG0000263
OrthoInspector 1 1.000 T97983
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11893
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.