DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Inx6 and inx-12

DIOPT Version :8

Sequence 1:NP_572374.1 Gene:Inx6 / 31645 FlyBaseID:FBgn0027107 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_491213.1 Gene:inx-12 / 171944 WormBaseID:WBGene00002134 Length:408 Species:Caenorhabditis elegans

Alignment Length:420 Identity:95/421 (23%)
Similarity:162/421 (38%) Gaps:106/421 (25%)


  Fly    31 TIVILLTCTFLLSAKQYFGEPILCLSSERQ----ADYVQSYCWTMGTYILPAEVDR-DGGSSWEY 90
            ||.::|...| ::...:.|.||.|......    |:|...||:...|:.:|...|: :...:|| 
 Worm    29 TIGLVLASAF-ITGWSFVGSPIDCWFPAYYKGWWAEYALDYCYVQNTFFVPFSEDKAERSYNWE- 91

  Fly    91 ALYAPTSTAAETFNVSSLRALVAQNEQYARFISIAEGVGPETRGVTKRMYLRYYQWVFMILLFQS 155
                  ...|:..|.:||:    |..|                       :.|||||..||..|:
 Worm    92 ------QLVADKQNTTSLK----QTNQ-----------------------IGYYQWVPFILALQA 123

  Fly   156 LLFYFPSFLWKVW---EGQRMEQLC--CEVGD--------------ALIVEATYRTRL--QMLTR 199
            :|||||..:|:::   .||.:..||  |...:              ..|.:..:|..:  |:...
 Worm   124 MLFYFPVVIWRLFYGMAGQNVTSLCNTCTATEGNEESRKGTITTIAGYISQKRHRNLIVKQLSGF 188

  Fly   200 YFRAQFAPIHWCYSIKYAFCELLNVFISILNFWLMDVVFNGFWYKYIHALAAIPVYDW------N 258
            ..||..:.:...|           :|:..|  :|::|:|.   :..:..:..:..|.|      :
 Worm   189 QNRANGSAVITSY-----------LFMKAL--FLINVLFQ---FVLLKRMLGVDSYFWGAEVTSD 237

  Fly   259 LWN---LMTSRVFPKVAKCEMFVYGPSGTPNI--MDILCVLPLNILNEKIFAVLYVWFLFIALLA 318
            ||:   ...:..||:|..||   |......||  ..:.|||.:|:.|||||..|:.|..|:.::.
 Worm   238 LWSGNEWPETGNFPRVTMCE---YEVRNLDNIHKHSVQCVLMINMFNEKIFVALWWWLCFLTVVT 299

  Fly   319 IMNILYRLLVICCPELRLQLLRTHL----------NGMPKSHVREVLASAGYGDWFVLMCVSINV 373
            |.|.:|.........:....:|.::          .|..:..|.|.|:.   ...|:|..:.:|.
 Worm   300 ITNTIYWFWRASGTSVSKNFIRPYVEDIDPKVKNNRGKLQQFVSEFLSP---DTVFILRLIELNN 361

  Fly   374 NPTLFRELLEQLYAKLNQARCTEPVFAEQP 403
            ..|...||:..::.:.|.|  ..|.::..|
 Worm   362 GKTPVVELIRDMWRRFNTA--VPPPYSAPP 389

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Inx6NP_572374.1 Innexin 21..389 CDD:279248 91/405 (22%)
inx-12NP_491213.1 Innexin 18..377 CDD:279248 91/405 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I3116
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D323554at33208
OrthoFinder 1 1.000 FOG0000263
OrthoInspector 1 1.000 T97983
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11893
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.160

Return to query results.
Submit another query.