DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Inx6 and inx-13

DIOPT Version :8

Sequence 1:NP_572374.1 Gene:Inx6 / 31645 FlyBaseID:FBgn0027107 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_491212.1 Gene:inx-13 / 171943 WormBaseID:WBGene00002135 Length:385 Species:Caenorhabditis elegans

Alignment Length:377 Identity:81/378 (21%)
Similarity:136/378 (36%) Gaps:126/378 (33%)


  Fly    21 DPIFTLHSKCTIVILLTCTFLLSAKQYFGEPILCLSSER----QADYVQSYCWTMGTYIL----- 76
            |.|..|:...|.::|:.....||||||.|:||.|....:    ...|.::||:...||.:     
 Worm    18 DSIDRLNYYWTPMLLVIFALTLSAKQYVGQPIQCWIPAQFTGAWEQYSENYCFVQNTYFISPDKY 82

  Fly    77 --PAEVDRDGGSSWEYALYAPTSTAAETFNVSSLRALVAQNEQYARFISIAEGVGPETRGVTKRM 139
              .:|:||:|..                                                     
 Worm    83 IPDSEIDREGAE----------------------------------------------------- 94

  Fly   140 YLRYYQWVFMILLFQSLLFYFPSFLWKVW---EGQRMEQLCCEVGDALIVEATYRTR-------- 193
             :.|||||..||..|::|||.||..|::.   .|..::::......|..|:...|..        
 Worm    95 -IGYYQWVPFILGLQAILFYLPSLFWRLMNFNSGVALKKMLFGAKKADRVDEKARNEAAKSTGAH 158

  Fly   194 -LQMLTRYFRAQFAPIHWCYSIKYAFCELLNVFISILNFWLMDVVFN--------GFWYKYIHAL 249
             .:.||  .:::||.....::...::...|.:|:..|  :|:.:||.        |..|.:    
 Worm   159 LYESLT--LQSRFAKYTSAFTYGGSYLTYLYLFVKFL--YLVQIVFQFIILNNFLGTSYTF---- 215

  Fly   250 AAIPVYDWNL-----------WNLMTSRVFPKVAKCEMFVYGPSGTPNIMDILCVLPLNILNEKI 303
                   |.|           |.  .|..||:|..|: |.....|..:...:.|||.:|:.|||:
 Worm   216 -------WGLGILSDILNGREWE--ESGHFPRVTMCD-FEVRVLGNKHRHTVQCVLMINMFNEKV 270

  Fly   304 FAVLYVWFLFIALLAIMNILYRLLVICCPELRLQLLRTHLNGMPKSHVREVL 355
            :..|:.|.:.:.:...:|     ||....:|..:..|       |:|::..|
 Worm   271 YVFLWFWLVIVGVATFLN-----LVNWTRKLMFRSAR-------KAHIKSYL 310

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Inx6NP_572374.1 Innexin 21..389 CDD:279248 81/378 (21%)
inx-13NP_491212.1 Innexin 17..366 CDD:279248 81/378 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2BWHM
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I3116
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000263
OrthoInspector 1 1.000 T97983
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11893
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.