DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: xit and AT2G44660

Sequence 1:NP_572355.1 Gene:xit FlyBaseID:FBgn0029906 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_181994.5 Gene:AT2G44660 AraportID:AT2G44660 Length:506 Species:Arabidopsis thaliana

Alignment Length:510 Identity:218/511 (43%)
Similarity:297/511 (58%) Gaps:63/511 (12%)


  Fly     4 LFWHLVGIATGLKILLIPAYHSTDFEVHRNWLAITHSLPLNQWYVDATSEWTLDYPPFFAYFEWL 68
            |.| ...:||.:|:||||:..||||||||||||||:||||.:||.|.||:|||||||||||||..
plant    12 LLW-FFAVATAVKLLLIPSSRSTDFEVHRNWLAITNSLPLTKWYFDETSQWTLDYPPFFAYFERF 75

  Fly    69 LSQVAKYVDPRMLVVD---NLNYESKATVYFQRLSVIVTDLVYVLGVRSCLGSL-GLGRDTQQFF 129
            ||..|:.||||  :||   .|:|.:::.:||||:||||:||..:.||......| .|.|:     
plant    76 LSIFARLVDPR--IVDLQSGLDYNAESVIYFQRISVIVSDLCLLYGVYRLTRKLEPLKRN----- 133

  Fly   130 AASMLLLLNVGLIFVDHIHFQYNGLLFGILLLSIGSLIRQRFLWSAFAFAVLLNFKHIFLYMAPA 194
            ....|::.:.||:.||||||||||.|.|.|||||..|...|.|...|.|||||.|||:|...||.
plant   134 LICALVIWSPGLLIVDHIHFQYNGFLLGWLLLSISFLQEGRDLLGGFLFAVLLCFKHLFAVTAPV 198

  Fly   195 FGVYLLRFYCLEQASVVSAVGAVVKLLVVGLTPFAVSFGPF--WQQLPQVLSRLFPFKRGLTHAY 257
            :.|||||.||  .:.:|:....:|.:..|.:..||.::|||  ..|:.||:||:|||.|||.|||
plant   199 YFVYLLRHYC--WSGLVTGFRRLVTIGAVVVAVFAAAYGPFIYHGQIQQVISRMFPFGRGLCHAY 261

  Fly   258 WAPNFWALYNAADKLAAGVLK-----VQDGGASTTSGLVQEVR-HSVLPAITPPVTFALTALFML 316
            ||||||..|...||..|.:|:     :|...||.|.|||.:.. .:|||.|||..|||:..|.:.
plant   262 WAPNFWVFYIILDKGLAVLLRKLGYEIQIPSASFTGGLVGDSSPFAVLPQITPLTTFAMVLLAIS 326

  Fly   317 PILVKLFRSAKKQSPLV--FLRAVVLCGCSSFVFGWHVHEKAILMVLLPLCLLTLVNREDARYAY 379
            |.|:|.::  |..|.||  ::.....||   |:|||||||||.|...:||.::.:.:.|||::.:
plant   327 PCLIKAWK--KPHSGLVARWVAYAYTCG---FLFGWHVHEKASLHFTIPLAIVAVQSLEDAKHYF 386

  Fly   380 VLGIAGYFSLFPLLFDADLYIPRYSLYMSYVAMMYGQLYRIFPGFRGFHT--------------- 429
            ::.|...:||:|||::...|..:..|.:.:..:|:       .||...:|               
plant   387 LVSIVSCYSLYPLLYEPQEYPIKVLLLLLHSVVMW-------LGFAAQYTDYKAQKKETSEIKSK 444

  Fly   430 -----LEWLYMLGFMAIPLYEHLLSFLLH---LDQRLPFLPLLLTSVYSALGVLY 476
                 .|..|::|.:.:    .::|..||   |..:||||||:|.|.|..:|::|
plant   445 FRIGCFEKSYLMGLIIV----EIVSQFLHPYFLGDKLPFLPLMLISTYCTVGIMY 495

Known Domains:


GeneSequenceDomainRegion External IDIdentity
xitNP_572355.1 Alg6_Alg8 12..478 CDD:281190 216/503 (43%)
AT2G44660NP_181994.5 Alg6_Alg8 19..499 CDD:281190 216/503 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H6931
Inparanoid 1 1.050 351 1.000 Inparanoid score I596
OMA 1 1.010
OrthoDB 1 1.010 D595382at2759
OrthoInspector 1 1.000 T193139
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12413
Phylome 00.000 Not matched by this tool.
77.170

Return to query results.
Submit another query.