DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: xit and ALG8

Sequence 1:NP_572355.1 Gene:xit FlyBaseID:FBgn0029906 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_076984.2 Gene:ALG8 HGNCID:23161 Length:526 Species:Homo sapiens

Alignment Length:538 Identity:259/539 (48%)
Similarity:334/539 (62%) Gaps:56/539 (10%)


  Fly    11 IATG--------------LKILLIPAYHSTDFEVHRNWLAITHSLPLNQWYVDATSEWTLDYPPF 61
            ||||              ||.||||.||||||||||||||||||||::|||.:||||||||||||
Human     6 IATGTGNWFSALALGVTLLKCLLIPTYHSTDFEVHRNWLAITHSLPISQWYYEATSEWTLDYPPF 70

  Fly    62 FAYFEWLLSQVAKYVDPRMLVVDNLNYESKATVYFQRLSVIVTDLVYVLGVR---SCLGSLGLGR 123
            ||:||::||.||||.|..||.|.||||.|..|:.|||.|||..|:::|..||   .|:....:|:
Human    71 FAWFEYILSHVAKYFDQEMLNVHNLNYSSSRTLLFQRFSVIFMDVLFVYAVRECCKCIDGKKVGK 135

  Fly   124 DTQQ--FFAASMLLLLNVGLIFVDHIHFQYNGLLFGILLLSIGSLIRQRFLWSAFAFAVLLNFKH 186
            :..:  .|..|:|||.|.||:.||||||||||.|||::||||..|.::|.:..||.|||||:|||
Human   136 ELTEKPKFILSVLLLWNFGLLIVDHIHFQYNGFLFGLMLLSIARLFQKRHMEGAFLFAVLLHFKH 200

  Fly   187 IFLYMAPAFGVYLLRFYCL----EQASVVSAVGAVVKLLVVGLTPF---AVSFGPF--WQQLPQV 242
            |:||:|||:||||||.||.    ...|:.....:.|:::.:||..|   |:|.|||  ..|||||
Human   201 IYLYVAPAYGVYLLRSYCFTANKPDGSIRWKSFSFVRVISLGLVVFLVSALSLGPFLALNQLPQV 265

  Fly   243 LSRLFPFKRGLTHAYWAPNFWALYNAADKLAAGV---LKVQDGG----ASTTSGLVQEVRHSVLP 300
            .||||||||||.||||||||||||||.||:.:.:   ||..|..    ||.||||||:.:|:|||
Human   266 FSRLFPFKRGLCHAYWAPNFWALYNALDKVLSVIGLKLKFLDPNNIPKASMTSGLVQQFQHTVLP 330

  Fly   301 AITPPVTFALTALFMLPILVKLFRSAKKQSPLVFLRAVVLCGCSSFVFGWHVHEKAILMVLLPLC 365
            ::||..|...|.:.:||.:..|:  .|.|.|..|||.:.||..|||:|||||||||||:.:||:.
Human   331 SVTPLATLICTLIAILPSIFCLW--FKPQGPRGFLRCLTLCALSSFMFGWHVHEKAILLAILPMS 393

  Fly   366 LLTLVNREDARYAYVLGIAGYFSLFPLLFDADLYIPRYSLYMSYVAMMYGQLYRIFPGFRG-FHT 429
            ||::....||....:|...|::|||||||.|.....:..|.:.:.......|..:|...:. |:.
Human   394 LLSVGKAGDASIFLILTTTGHYSLFPLLFTAPELPIKILLMLLFTIYSISSLKTLFRKEKPLFNW 458

  Fly   430 LEWLYMLGFMAIPLYEHLLSFLLHLDQ---RLPFLPLLLTSVYSALGVLYFFGAYYLYALGISWG 491
            :|..|:||..  || |....|:.....   :.||:||||||||.|:|:.|            :|.
Human   459 METFYLLGLG--PL-EVCCEFVFPFTSWKVKYPFIPLLLTSVYCAVGITY------------AWF 508

  Fly   492 KVPIASSTSAAAVKRKRK 509
            |:.::....:|..|.|::
Human   509 KLYVSVLIDSAIGKTKKQ 526

Known Domains:


GeneSequenceDomainRegion External IDIdentity
xitNP_572355.1 Alg6_Alg8 12..478 CDD:281190 253/505 (50%)
ALG8NP_076984.2 Alg6_Alg8 22..508 CDD:281190 251/503 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C262820766
eggNOG 1 0.900 E1_KOG2576
Hieranoid 1 1.000
Homologene 1 1.000 H6931
Inparanoid 1 1.050 446 1.000 Inparanoid score I1612
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D379099at33208
OrthoFinder 1 1.000 FOG0004496
OrthoInspector 1 1.000 T1075479
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12413
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.870

Return to query results.
Submit another query.