DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: xit and alg6

Sequence 1:NP_572355.1 Gene:xit FlyBaseID:FBgn0029906 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001011458.1 Gene:alg6 XenbaseID:XB-GENE-998187 Length:506 Species:Xenopus tropicalis

Alignment Length:510 Identity:149/511 (29%)
Similarity:225/511 (44%) Gaps:103/511 (20%)


  Fly    27 DFEVHRNWLAITHSLPLNQWYVDATSE----WTLDYPPFFAYFEWLLSQVAKYVDPRMLVVD-NL 86
            |:|..|:|..||.|||:.|||.::|..    |.|||||..||..:|..|:|..::|..:.:: :.
 Frog    37 DYEAQRHWQEITFSLPVKQWYFNSTDNNLQYWGLDYPPLTAYHSFLCGQIAHLLNPDWVALNASR 101

  Fly    87 NYESKATVYFQRLSVIVTDL-VYVLGV---RSCLGSLGLGRDTQQFFAASMLLLLNVGLIFVDHI 147
            .|||.....|.|.:|:|.|| :|:..|   ..|:..:    .:::..::...:||..|||.:|:.
 Frog   102 GYESLQHKLFMRATVLVADLIIYIPAVIVYCFCMREI----PSKKKISSLCCILLYPGLILIDYG 162

  Fly   148 HFQYNGLLFGILLLSIGSLIRQRFLWSAFAFAVLLNFKHIFLYMAPAFGVYLLRFYCLEQASVVS 212
            |||||.:..|..|..:.:|..:..|..:|.|...||:|.:.||.:..|..|||. .||:......
 Frog   163 HFQYNSVSLGFALWGVIALSFEWHLLGSFVFCFALNYKQMELYHSLPFFCYLLG-RCLKGGITGR 226

  Fly   213 AVGAVVKLLVVGLTPFAVSFGPF---WQQLPQVLSRLFPFKRGLTHAYWAPNFWALYNAADKLAA 274
            .:..:.|:.|..:..||:.:.||   .:|:.|||.||||..|||.....| |.|...:|      
 Frog   227 GLFLLFKIGVTVIASFALCWIPFLTETEQILQVLRRLFPVGRGLFEDKVA-NIWCSLSA------ 284

  Fly   275 GVLKVQDGGASTTSGLVQEVRHSVLPAITPPVTFALTALFMLPILVKLFRSAKKQSPLV--FLRA 337
             :.||:. ..|:.|.|.              ::|..|.|.:||..:||     ...|.|  |..|
 Frog   285 -IFKVKK-MLSSESQLY--------------LSFLCTLLSVLPSCIKL-----TMQPSVRRFKFA 328

  Fly   338 VVLCGCSSFVFGWHVHEKAILMVLLPLCLLTLVNREDARYAYVLGIAGYFSLFPLLFDADLYIPR 402
            :|.|..|.|::.:.||||:||:|.||:.|  ::|.......:.| :...||:.|||.       :
 Frog   329 LVNCALSFFLYSFQVHEKSILLVSLPVSL--IINDAPLISTWFL-LVSTFSMLPLLL-------K 383

  Fly   403 YSLYMSYVAMMYGQLY---------------------------RIFPGFR--------GFHTLEW 432
            ..|.|:|:......|.                           |..|.||        .|.|   
 Frog   384 DGLLMAYIITTLVFLLVSKSLLPAPENMSEESINLKPFCISVRRYLPWFRLPGYLIKLSFCT--- 445

  Fly   433 LYMLGFMAIPLYEHLLSFLLHLDQRLPFLPLLLTSVYSA---LGVLYFFGAYYLY 484
             .::|..|:.    |.|.:|....|||.|..:|.|.:|.   |..|::|...|.:
 Frog   446 -SLMGMAALT----LASAVLVPPPRLPDLFPVLVSSFSCVHFLAFLFYFNIIYFW 495

Known Domains:


GeneSequenceDomainRegion External IDIdentity
xitNP_572355.1 Alg6_Alg8 12..478 CDD:281190 147/503 (29%)
alg6NP_001011458.1 Alg6_Alg8 32..485 CDD:308661 146/499 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D379099at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.