DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: xit and alg6

Sequence 1:NP_572355.1 Gene:xit FlyBaseID:FBgn0029906 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001003784.2 Gene:alg6 ZFINID:ZDB-GENE-040808-45 Length:506 Species:Danio rerio

Alignment Length:533 Identity:151/534 (28%)
Similarity:233/534 (44%) Gaps:109/534 (20%)


  Fly     6 WHLVGIAT--GLKILLIPAYHS----------TDFEVHRNWLAITHSLPLNQWYVDATSE----W 54
            |.|:.:..  ||......::||          .|:|..|:|..:|::||:::||.:.|:.    |
Zfish     4 WSLISLCVLLGLTSRWAVSFHSYSGAGKPPMFGDYEAQRHWQELTYNLPVHEWYFNTTNNDLNYW 68

  Fly    55 TLDYPPFFAYFEWLLSQVAKYVDPRMLVVD-NLNYESKATVYFQRLSVIVTD-LVYVLGV----- 112
            .|||||..||.....:.:||..:|..:.:. :..|||.:...|.|.:|:..| |:|:..|     
Zfish    69 GLDYPPLTAYHSLACAYIAKLFNPEWVELHASRGYESHSHKLFMRATVLFADALIYIPAVLLYCF 133

  Fly   113 RSCLGSLGLGRDTQQFFAASMLLLLNVGLIFVDHIHFQYNGL-----LFGILLLSIGSLIRQRFL 172
            ..|.||      .:|..|.:..:|:..||:.:|:.||||||:     |:|:|.|.:|        
Zfish   134 YFCDGS------PKQKVATAFCILMYPGLMLIDYGHFQYNGVSLGLALWGVLGLGLG-------- 184

  Fly   173 WSAF---AFAVLLNFKHIFLYMAPAFGVYLLRFYCLEQASVVSAVGAVVKLLVVGLTPFAVSFGP 234
            |..|   ||.:.||:|.:.||.|..|..|||. .|::..........:||:.:..|..||:.:.|
Zfish   185 WDLFGSVAFVLALNYKQMELYHALPFFCYLLG-KCVKHGLNGQGFFHLVKISLTVLVTFALCWMP 248

  Fly   235 FW---QQLPQVLSRLFPFKRGLTHAYWAPNFWALYNAADKLAAGVLKVQDGGASTTSGLVQEVRH 296
            |.   :|..|||.||||..|||.....| |.|...|...|:..               |:.....
Zfish   249 FLSDPKQPLQVLHRLFPVGRGLFEDKVA-NTWCSLNVLIKIKT---------------LLSRETQ 297

  Fly   297 SVLPAITPPVTFALTALFMLPILVKLFRSAKKQSPLVFLRAVVLCGCSSFVFGWHVHEKAILMVL 361
            ..|       :||||.||:||..:||.   .|.:...|..|:|....:.|:|.:.||||:||:..
Zfish   298 LFL-------SFALTVLFVLPSSLKLL---SKPTLWQFKLALVNSSLAFFLFSFQVHEKSILLAA 352

  Fly   362 LPLCLLTLVNREDARYAYVLGIAGYFSLFPLLFDADLYIPRYSLYMSYVAMMYGQLY-------- 418
            ||:||  ::|.......:.| :...||:.|||....|.:|   ..::.:|.::..||        
Zfish   353 LPVCL--VINEMPLIAVWFL-LTSTFSMLPLLLKDGLLLP---YVVTSLAFLFLSLYLLSALERS 411

  Fly   419 ---------------RIFPGFRGFHTLEWLYMLGFMAIPLYEHLLSFLLHLDQRLPFLPLLLTSV 468
                           ...|.......::|.:.|..:|:.... :.|..|....:||.|..:|.|:
Zfish   412 TDEELRLAPYRKLTQHFLPKLNLSRIVKWKFWLSLVAMAALS-ITSVWLEPPPKLPDLFPVLVSI 475

  Fly   469 YSALG----VLYF 477
            :|.|.    |:||
Zfish   476 FSFLHFLGFVIYF 488

Known Domains:


GeneSequenceDomainRegion External IDIdentity
xitNP_572355.1 Alg6_Alg8 12..478 CDD:281190 149/528 (28%)
alg6NP_001003784.2 Alg6_Alg8 32..486 CDD:281190 143/502 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D379099at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.